HomeMy WebLinkAboutAgenda CC 03.24.2015 WorkshopNotice of Meeting of the
Governing Body of the
City of Georgetown, Texas
MARCH 24, 2015
The Georgetown City Council will meet on MARCH 24, 2015 at 3:00 P.M. at the Council Chambers, 101 E.
7th St., Georgetown, Texas
The City of Georgetown is committed to compliance with the Americans with Disabilities Act (ADA). If you
require assistance in participating at a public meeting due to a disability, as defined under the ADA,
reasonable assistance, adaptations, or accommodations will be provided upon request. Please contact the City
Secretary's Office, least four (4) days prior to the scheduled meeting date, at (512) 930-3652 or City Hall at
113 East 8th Street for additional information; TTY users route through Relay Texas at 711.
Policy Development/Review Workshop -
A Presentation and discussion on Garey Park design and operations/maintenance plan -- Brian
Binkowski, PLA, ASLA, Director of Planning for Baker-Aicklen and Associates, Inc., Kimberly
Garrett, Parks and Recreation Director and Laurie Brewer, Assistant City Manager
B Discussion on proposed amendments to the Unified Development Code (UDC) relating to the
development standards, rules, and procedures that affect properties located in a Historic Overlay
District and/or listed on the Historic Resource Survey -- Matt Synatschk, Historic Planner, Andreina
Davila-Quintero, Project Coordinator and Laurie Brewer, Assistant City Manager
C Update on Public Safety Operations and Training Center -- Codi Newsom, Senior Project Manager and
Wayne Nero, Chief of Police
D Georgetown Fire Department Paramedic and TRV Program -- John Sullivan, Fire Chief
Executive Session
In compliance with the Open Meetings Act, Chapter 551, Government Code, Vernon's Texas Codes,
Annotated, the items listed below will be discussed in closed session and are subject to action in the regular
session.
E Sec. 551.071: Consultation with Attorney
- Advice from attorney about pending or contemplated litigation and other matters on which the
attorney has a duty to advise the City Council, including agenda items
- EMS Contract Discussion
- Meet and Confer
Sec. 551.074: Personnel Matters
- Interim City Manager, City Attorney, City Secretary and Municipal Judge: Consideration of the
appointment, employment, evaluation, reassignment, duties, discipline, or dismissal
- Review and discussion of City Manager position
- Interim City Manager Compensation
Adjournment
Certificate of Posting
I, Jessica Brettle, City Secretary for the City of Georgetown, Texas, do hereby certify that this Notice of
Meeting was posted at City Hall, 113 E. 8th Street, a place readily accessible to the general public at all
times, on the _____ day of _________________, 2015, at __________, and remained so posted for at least
72 continuous hours preceding the scheduled time of said meeting.
__________________________________
Jessica Brettle, City Secretary
City of Georgetown, Texas
City Council Agenda
March 24, 2015
SUBJECT:
Presentation and discussion on Garey Park design and operations/maintenance plan -- Brian Binkowski,
PLA, ASLA, Director of Planning for Baker-Aicklen and Associates, Inc., Kimberly Garrett, Parks and
Recreation Director and Laurie Brewer, Assistant City Manager
ITEM SUMMARY:
Garey Park is a 525 acre park donated to the City of Georgetown by Jack and Cammy Garey. In addition to
the land, the Garey's have also pledged a minimum of $5 Million towards development of the park. The
citizens of Georgetown passed a bond in November 2008 to fund the development of Garey Park. On May
13, 2014, City Council approved a MOU with Mr. Jack Garey related to the development and timing of the
improvements. Also on May 13th the City Council approved a task order with Baker-Aicklen and Associates
for landscape architect design services of Garey Park. As part of the design process, staff along with the
consultant have been working on an operations and maintenance plan for the park. The design plan is based
on the Garey Park Master Plan that was adopted by City Council in May 2005.
The Parks and Recreation Advisory Board along with Mr. Jack Garey and his son Glen Garey, reviewed and
made recommendations on the schematic plan at the January 8, 2015, meeting. At the March 16th special
meeting, the Parks and Recreation Advisory Board reviewed the operations and maintenance plan which
included both estimated expenses and revenues. The operations and maintenance plan is based on schematic
designs and not actual construction documents. At this time, the start of construction is unknown based on
the MOU. This operation and maintenance plan will allow City staff to continue to refine and adjust the
construction documents to plan for sustainable, efficient and low maintenance facilities. City staff will
continue to explore additional programming and revenue generation opportunities. Assisting with the
operations and maintenance plan is Jim Rodgers, former Parks and Recreation Director with the City of
Austin, City of Cedar Park and Williamson County.
Garey Park by its size, design, and location will be a regional park similar to a state park. It will host visitors
from all of the surrounding cities as well as the city of Austin. Just as in a state park, an entry fee to the park
is proposed to help generate revenue from visitors, especially non Georgetown residents. Due to the unique
nature of the park many other opportunities for generating revenue exist in the park. These revenues will be
used to help offset the operating expenses. The expense calculations were derived from actual contracts the
Parks and Recreation Department currently has in place as well as professional contacts with numerous other
parks and recreation entities and Texas Parks and Wildlife Department. The development of Garey Park is an
investment in the future of Georgetown. This park has great potential to generate a positive economic impact
for the Georgetown community.
FINANCIAL IMPACT:
NA
SUBMITTED BY:
Kimberly Garrett, Parks and Recreation Director
ATTACHMENTS:
Operations Summary
Gary Park OPCC at Schematic Design Level
Cover Memo
Item # A
Garey Park
Estimated
Revenue & Expense
Summary
Schematic Design Level
March 24, 2015
Attachment number 1 \nPage 1 of 13
Item # A
BA Project No.0686-016
Engineers Surveyors GIS Planners Landscape Architects
507 W. Liberty Avenue Round Rock, Texas 78664 Phone: 512/244-9620 Fax: 512/244-9623
Garey Park | Expense & Revenue Summary
3.24.15
Total Estimated Expenses $ 963,596*
Total Estimated Revenue $ 749,350**
Disclaimers:
1) Difference of $ 214,246 (78% recovery of expenses) at this level of detail. Percentage will
decrease with additional refinement to design and expenses.
2) * Does not take into account Internal Service Fund (ISF).
3) ** Estimated Revenue at this level of detail and programming identified.
4) Expenses and Revenue are based on “today’s dollars”.
Attachment number 1 \nPage 2 of 13
Item # A
BA Project No.0686-016
Page 1 of 2
Engineers Surveyors GIS Planners Landscape Architects
507 W. Liberty Avenue Round Rock, Texas 78664 Phone: 512/244-9620 Fax: 512/244-9623
Garey Park | Summary of O/M Cost
3.24.15
Personnel Quantity
Park Supervisor 1
$56,000 Extended 40% $78,400
Equestrian Foreman 1 (Arena, trails 1.03)
$48,000 Extended 40% $67,200
Park Maint Worker (Sr) 1 (1Garey Play/dog-1.28)
$38,000 Extended 40% $53,200
Park Maint Worker 1 (1retreat, group,primitive 1.23)
$32,000 Extended 40% $44,800
Entry Booth/Fee Collections 2.5 (Entry Booth 2.78)
$68,750 Extended 40% $94,850
Event Specialist 1 (Event Center, Amphi, Retreat/camping coordinator)
$40,000 Extended 40% $56,000
7.5 Subtotal FTE’s $394,450
Seasonal Employees 3 (High use season 800x3x$10)
$24,000 Extended 7.65% $ 25,836
Total Personnel $420,286
Operation Contract Items
Mowing & Grounds Maintenance Contract $100,385
Cleaning and Custodial Maintenance Contract $124,425
(1659 Cleans at $75 per)
Cleaning and Custodial Maintenance Contract $ 26,000
(104 Events at $250)
Pond Maintenance $ 7,500
(3.1 acres of ponds)
Total Operational Contract Items $ 258,310
Attachment number 1 \nPage 3 of 13
Item # A
BA Project No.0686-016
Page 2 of 2
Engineers Surveyors GIS Planners Landscape Architects
507 W. Liberty Avenue Round Rock, Texas 78664 Phone: 512/244-9620 Fax: 512/244-9623
Other Annual Costs
Utilities $175,000
General Maintenance $ 50,000
Grounds Maintenance $ 60,000
Total $ 285,000
Grand Total $963,596
Equipment (one time purchase)
Black Widow Drag $ 5,250
60 hp Tractor $ 28,000
Water Water wagon $ 7,000
Utility Vehicles (3) $ 49,500
Truck (1) $ 30,000
Computer (2) printer $ 5,000
Trailer Mounted Pressure Washer $ 9,000
Covered trailer w Tables and chairs $ 22,800
Total Equipment $ 156,550
Attachment number 1 \nPage 4 of 13
Item # A
BA Project No.0686-016
Engineers Surveyors GIS Planners Landscape Architects
507 W. Liberty Avenue Round Rock, Texas 78664 Phone: 512/244-9620 Fax: 512/244-9623
Garey Park | Contractual Mowing
3.24.15
Maintenance Level
A – highly manicured areas
B – moderately manicured areas
C – minimal manicured areas
A Mowing, trimming, Blowing, beds (60 times per year @ $120 per acre)
A Event Center (Garey House) 4.28
Total A 4.28 acres $ 30,816
Level
B Mowing, trimming,Blowing (36 times per year @ $46 per acre)
B Entry 1.12
B Rd to Maint Fac 0.38
B Maint, Dog,Play, open Play,Equine, 15.40
B Amphitheater 0.21
B Open Play Parking 5.00
B Retreat camp 1.50
B Group Camping 2.20
B Primitive Camping 4.00
B From Entry to Garey House 0.60
B To Group Camping 0.44
B Entry to Garey House to Equine 1.10
B Trail Edges 4.12
Total B 36.07 acres $ 59,732
Level
C Native Grass mowing rough no trim (1 time per year @ $45 per acre)
C Garey Meadow west 39.80
C Garey Meadow (primitive) 8.40
C Entry Road East 29.50
C Entry Road West 90.00
C Maint Facility Garey House 24.00
C Retreat 13.80
C Retreat South 13.10
Total C 218.60 acres $ 9,837
Total Contractual Mowing $100,385
Attachment number 1 \nPage 5 of 13
Item # A
BA Project No.0686-016
Engineers Surveyors GIS Planners Landscape Architects
507 W. Liberty Avenue Round Rock, Texas 78664 Phone: 512/244-9620 Fax: 512/244-9623
Garey Park | Contractual Cleaning Restrooms
3.24.15
Equestrian Restrooms 208 Cleans
Equestrian Stalls 208 Cleans
Garey Play/ Dog 345 Cleans
Forum/Amphitheater 345 Cleans
Group Camping 345 Cleans
Primitive Camping 208 Cleans
Total 1659 Cleans @ $75 per Clean
Total Contractual Cleaning Restrooms $124,425
Attachment number 1 \nPage 6 of 13
Item # A
BA Project No.0686-016
Engineers Surveyors GIS Planners Landscape Architects
507 W. Liberty Avenue Round Rock, Texas 78664 Phone: 512/244-9620 Fax: 512/244-9623
Garey Park | Estimated Revenue Summary
3.24.15
Event/Activity Rate per Event/Activity Frequency Est. Total
Entry $2.00 per person 59,000/year $118,000
Equestrian
Annual Membership $200.00 30 passes/year $ 6,000
Trail Pass (12)
Per visit $10.00 4,000 visits/year $ 40,000
Clinic Rentals $300.00 25 rentals/year $ 7,500
Garey House Event
Weekend events $4,000 38 rentals/year $152,000
Weekday $2,500 20/rentals/year $ 50,000
Pavilion Rental
Small Play/Dog $25.00 824 rentals/year $ 20,600
Large $40.00 180 rentals/year $ 7,200
Camping
Retreat $110.00 720 rentals/year $ 79,200
Group $80.00 1,120 rentals/year $ 89,600
Primitive $10.00 264 rentals/year $ 2,640
Amphitheater $8,000 4 rentals/year $ 32,000
Wedding Shelter
(Not Garey House) $25.00 50 rentals/year $ 1,250
Programs*
Overnight Camp $280.00 512 participants/yr. $143,360
Total Estimated Revenue $749,350
* Refer supplemental “Revenue Ideas” for additional program ideas.
Attachment number 1 \nPage 7 of 13
Item # A
BA Project No.0686-016
Page 1 of 2
Engineers Surveyors GIS Planners Landscape Architects
507 W. Liberty Avenue Round Rock, Texas 78664 Phone: 512/244-9620 Fax: 512/244-9623
Garey Park | Revenue Ideas
List by City PARD 3.24.15
Event Fee/Revenue
Mobile Art Displays Park Entrance Fee During Jan/Feb when
programming would be slower.
Mobile Museum Displays Park Entrance Fee During Jan/Feb when
programming would be slower.
Star Gazing Events Park Entrance Fee/Programming
Fee/ Sell books about astronomy
Work with Southwestern or UT
Movie in the Park Park Entrance Fee/Programming
Fee/Concessions
Plays at
Amphitheater/Shakespeare
Park Entrance Fee/Programming
Fee/Concessions
Work with Southwestern or Palace
Theater
Home and Garden Shows Park Entrance Fee/Programming
Fee/Booth Fees/Concessions
Dog Shows Park Entrance Fees/Rental Fee
for facility/Concessions
Initially work with 4-H groups and
grow to major competitions.
Horse Shows Park Entrance Fees/Rental Fee
for facility/Concessions
Food and Wine Festivals Park Entrance Fees/Rental Fee
for facility/Concessions
Music Festivals Park Entrance Fees/Rental Fee
for facility/Concessions
Trail of Lights Parks Entrance Fees/Program fee
Artisan Festivals Parks Entrance Fee/Booth
Fees/Concessions
Hot Air Balloon Festival Parks Entrance Fee/Concessions
Kite Flying Festival Park Entrance Fee
Adventure Programs Park Entrance Fee/Program Fee
Attachment number 1 \nPage 8 of 13
Item # A
BA Project No.0686-016
Page 2 of 2
Engineers Surveyors GIS Planners Landscape Architects
507 W. Liberty Avenue Round Rock, Texas 78664 Phone: 512/244-9620 Fax: 512/244-9623
Annual Park Pass –
nonrefundable
For Park Entrance Only Would do per individual and/or
Family Pass (4 people). If
everyone received a photo
membership card. Otherwise
people could just pass it around
the neighborhood.
Gift Shop Sell sunscreen, bug spray, first aid
items. Park T-shirts. Vending.
Camping Parks Entrance Fee/Site fee
Pavilion Rentals Parks Entrance Fee/Pavilion Fee
Rental of House
Flower/Plant Shows
Day Camps Program fee
School Field Trips Program fee
Mother/Daughter Event Program fee
Zipline Program fee
Family Camping 101 Program fee
Attachment number 1 \nPage 9 of 13
Item # A
Garey Park
Operations and Maintenance Plan
3.24.15
LOCATIONS & TASKS UNIT TOTAL UNITS HRS/UNIT FREQUENCY
PER YEAR
TOTAL
#HRS
# STAFF PERSONNEL
TYPE
Park Entries Gate house
Staff Entry booth 1 12.5 345 4312.5 2.07 O
Restroom Cleaning Stalls 0 0.17 345 00.00 C
Mowing (Class A)Acre 4.28 0.5 36 0.00 C
Trimming (Edging)1000LF 7.5 1 36 0.00 C
Tree Trimming Acre 0.25 8 2 0.00 M
Trail Maintenance (Concrete)Mile 0.09 0.5 36 0.00 M
Trail Maintenance (Granite)Mile 0 4 12 0 0.00 M
Parking Spaces 6 0.01 12 0.00 M
Sign Maintenance Each 12 0.1 12 0.00 M
Trash Containers Each 0 0.05 52 0 0.00 M
Litter Control Acre 0.33 0.5 345 0.00 M
Direct Personnel Hours 4312.5 2.07
Indirect Personnel Costs and
Hours (Admin,Travel, Preparation,
Repairs, Training) 20% 862.5 0.41
Paid Time Off (Holidays, Vacation,
Sick) 13.85%597.28 0.29
TOTALS (Direct and Indirect
Personel Hours)5772.28 2.78
LOCATIONS & TASKS UNIT TOTAL UNITS HRS/UNIT FREQUENCY
PER YEAR
TOTAL
#HRS
# STAFF PERSONNEL
TYPE
Equestrian
Indoor Arena Conditioning 60000 sf 3 4 50 600 0.29 M
Light Maint
Restroom Cleaning/Flush Stalls 6 0.17 208 0.00 C
Horse Stall Maint/Horse wash area Stalls 7 0.17 208 0.00 C
Mowing Acre 0 0.5 12 0 0.00 C
Trimming (Edging)1000LF 0 1 4 0 0.00 C
Tree Trimming Acre 0 16 6 0 0.00 M
Trail Obstacle Maintenance Each 4 1.5 50 300 0.14 M
Trail Maintenance (Native)Mile 6 2 50 600 0.29 M
Parking Spaces 0 0.01 12 0 0.00 M
Sign Maintenance Each 0 0.25 12 0 0.00 M
Trash Containers Each 0 0.05 52 0 0.00 M
Litter Control Acre 2 0.5 104 104 0.05 M
Direct Personnel Hours 1604 0.77
Indirect Personnel Costs and
Hours (Admin,Travel, Preparation,
Repairs, Training) 20% 320.8 0.15
Paid Time Off (Holidays, Vacation,
Sick) 13.85%222.15 0.11
TOTALS (Direct and Indirect
Personel Hours)2146.95 1.03
LOCATIONS & TASKS UNIT TOTAL UNITS HRS/UNIT FREQUENCY
PER YEAR
TOTAL
#HRS
# STAFF PERSONNEL
TYPE
Garey Play Ranch
Play Maint Each 1 2 156 312 0.15
M
Splash Pad Each 1 0.5 66 33 0.02 M
Playscape Inspection (High)Each 1 1 52 52 0.03 M
Playscape Inspection (Low)Each 1 4 12 48 0.02 M
Restroom Cleaning High Stalls 8 0.17 345 C
Restroom Cleaning Low Stalls 8 0.07 150 C
Pavilion lg Each 1 0.75 52 39 0.02 M
Pavilion sm Each 4 0.5 26 52 0.03 M
Mowing Class A
(play/dog/open/maint/eq/rd)Acre 17.5 0.5 36 C
Trimming
(play/dog/open/maint/eq/rd)1000LF 29.4 1 36 C
Blower Maintenance 1000SF 328 0.05 36 C
Bench Maintenance
Tree Trimming Acre 2 8 2 0.00 M
Irrigation 0
Bench Maintenance Each 0 0.5 2 0 0.00 M
Trail Maintenance (Concrete)Mile 0 0.5 12 0 0.00 M
Trail Maintenance (Granite)Mile 0 4 12 0 0.00 M
Parking Spaces 0 0.01 12 0 0.00 M
Sign Maintenance Each 0 0.25 12 0 0.00 M
Splash Pad Each 0 0.5 12 0 0.00 M
Trash Containers Each 0 0.05 52 0 0.00 M
Litter
Control(play/dog/open/maint/eq/rd)Acre 6 0.5 345 1035 0.50 M
Fence Maint
Direct Personnel Hours 1571 0.76
Indirect Personnel Costs and
Hours (Admin,Travel, Preparation,
Repairs, Training) 20% 314.2 0.15
Paid Time Off (Holidays, Vacation,
Sick) 13.85%217.58 0.10
TOTALS (Direct and Indirect
Personel Hours)2102.78 1.01
Attachment number 1 \nPage 10 of 13
Item # A
Garey Park
Operations and Maintenance Plan
LOCATIONS & TASKS UNIT TOTAL UNITS HRS/UNIT FREQUENCY
PER YEAR
TOTAL
#HRS
# STAFF PERSONNEL
TYPE
Garey Dog Park
Pavilion Each 3 0.5 208 312 0.15 M
Entry,Walkway,Wash area Clean Each 1 0.5 208 104
0.05
M
Irrigation Acre 0.5
Bench Maintenance Each 0 0.5 2 0 0.00 M
Trail Maintenance (Concrete)Mile 0 0.5 12 0 0.00 M
Trail Maintenance (Granite)Mile 0 4 12 0 0.00 M
Parking Spaces 0 0.01 12 0 0.00 M
Sign Maintenance Each 0 0.25 12 0 0.00 M
Trash Containers Each 0 0.05 52 0 0.00 M
Litter Control Acre 0 0.5 12 0 0.00 M
Direct Personnel Hours 416 0.20
Indirect Personnel Costs and
Hours (Admin,Travel, Preparation,
Repairs, Training) 20% 83.2 0.04
Paid Time Off (Holidays, Vacation,
Sick) 13.85%57.62 0.03
TOTALS (Direct and Indirect
Personel Hours)556.82 0.27
LOCATIONS & TASKS UNIT TOTAL UNITS HRS/UNIT FREQUENCY
PER YEAR
TOTAL
#HRS
# STAFF PERSONNEL
TYPE
Open Play Active Parking
Mowing * 5acres Acre
0 0.5 12 0 0.00 C
Trimming (Edging)* 1000LF
0 1 4 0 0.00 C
Tree Trimming Acre
0 16 6 0 0.00 M
Irrigation Acre 5
Bench Maintenance Each
0 0.5 2 0 0.00 M
Trail Maintenance (Concrete) Mile
0 0.5 12 0 0.00 M
Trail Maintenance (Native) Mile
0 8 12 0 0.00 M
Trail Maintenance (Granite) Mile
0 4 12 0 0.00 M
Parking Spaces
110 0.01 12 13.2 0.01 M
Sign Maintenance Each
0 0.25 12 0 0.00 M
Trash Containers Each
0 0.05 52 0 0.00 M
Litter Control Acre
5 0.25 104 130 0.06 M
Direct Personnel Hours 143.2 0.07
Indirect Personnel Costs and
Hours (Admin,Travel, Preparation,
Repairs, Training) 20%
28.64 0.01
Paid Time Off (Holidays, Vacation,
Sick) 13.85%
19.83 0.01
TOTALS (Direct and Indirect
Personel Hours)
191.67 0.09
LOCATIONS & TASKS UNIT TOTAL UNITS HRS/UNIT FREQUENCY
PER YEAR
TOTAL
#HRS
# STAFF PERSONNEL
TYPE
Event Area (Garey House)
Event Clean Each 104 C
Restroom Cleaning/Flush Stalls 0 0.17 205 0 0.00 C
Mowing Acre 4.28 0.5 60 128.4 0.06 C
Trimming (Edging)1000LF 4.56 1 60 273.6 0.13 C
Tree Trimming Acre 4.5 16 2 144 0.07 M
Irrigation 0
Trail Maintenance (Concrete)Mile 0 0.5 12 0 0.00 M
Trail Maintenance (Native)Mile 0 8 12 0 0.00 M
Trail Maintenance (Granite)Mile 0 4 12 0 0.00 M
Parking Spaces 33 0.01 12 3.96 0.00 M
Sign Maintenance Each 0 0.25 12 0 0.00 M
Trash Containers Each 0 0.05 52 0 0.00 M
Litter Control Acre 0 0.5 12 0 0.00 M
Pond Maint acre 3.1 C
Direct Personnel Hours 549.96 0.26
Indirect Personnel Costs and
Hours (Admin,Travel, Preparation,
Repairs, Training) 20% 109.992 0.05
Paid Time Off (Holidays, Vacation,
Sick) 13.85%76.17 0.04
TOTALS (Direct and Indirect
Personel Hours)736.12 0.35
LOCATIONS & TASKS UNIT TOTAL UNITS HRS/UNIT FREQUENCY
PER YEAR
TOTAL
#HRS
# STAFF PERSONNEL
TYPE
The Forum/Amphitheater
Restroom Cleaning High Stalls 8 0.17 345 0.00 C
Restroom Cleaning Low Stalls 8 0.07 150 0.00 C
Mowing Acre 0.21 0.5 36 0.00 C
Trimming (Edging)1000LF 2 1 36 0.00 C
Tree Trimming Acre 0.25 8 2 0.00 M
Bench Maintenance 100LF 8 0.25 12 24 0.01 M
Trail Maintenance (Concrete)Mile 0 0.5 12 0 0.00 M
Trail Maintenance (Native)Mile 0 8 12 0 0.00 M
Sign Maintenance Each 0 0.25 12 0 0.00 M
Trash Containers Each 0 0.05 52 0 0.00 M
Litter Control Acre 0.4 0.5 208 41.6 0.02 M
Direct Personnel Hours 24 0.01
Indirect Personnel Costs and
Hours (Admin,Travel, Preparation,
Repairs, Training) 20% 4.8 0.00
Paid Time Off (Holidays, Vacation,
Sick) 13.85%3.32 0.00
TOTALS (Direct and Indirect
Personel Hours)32.12 0.02
Attachment number 1 \nPage 11 of 13
Item # A
Garey Park
Operations and Maintenance Plan
LOCATIONS & TASKS
UNIT TOTAL UNITS HRS/UNIT
FREQUENCY
PER YEAR
TOTAL
#HRS # STAFF
PERSONNEL
TYPE
Retreat Camping
Cabin Cleaning Each 9 0.5 208 936 0.45 C
Mowing Acre 1.5 0.5 36 0.00 C
Trimming (Edging)1000LF 7.6 1 36 0.00 C
Tree Trimming Acre 10 8 2 160 0.08 M
Trail Maintenance (Concrete)Mile 0.36 0.5 12 2.16 0.00 M
Trail Maintenance (Native)Mile 0 8 12 0 0.00 M
Trail Maintenance (Granite)Mile 0 4 12 0 0.00 M
Parking Spaces 0 0.01 12 0 0.00 M
Sign Maintenance Each 0 0.25 12 0 0.00 M
Trash Containers Each 0 0.05 52 0 0.00 M
Litter Control Acre 1.5 0.5 345 258.75 0.12 M
Direct Personnel Hours 1356.91 0.65
Indirect Personnel Costs and
Hours (Admin,Travel, Preparation,
Repairs, Training) 20% 271.382 0.13
Paid Time Off (Holidays, Vacation,
Sick) 13.85%187.93 0.09
TOTALS (Direct and Indirect
Personel Hours)1816.22 0.87
LOCATIONS & TASKS UNIT TOTAL UNITS HRS/UNIT FREQUENCY
PER YEAR
TOTAL
#HRS
# STAFF PERSONNEL
TYPE
Group Camping
Restroom Cleaning High Stalls 8 0.75 345 0.00 C
Restroom Cleaning Low Stalls 8 0.1 150 0.00 C
Cabin Cleaning Each
8 0.75 52 312 0.15 C
Mowing Acre 2.2 0.5 36 0.00 C
Trimming (Edging) 1000LF
4.5 1 36 0.00 C
Tree Trimming Acre
1.5 8 2 24 0.01 M
Trail Maintenance (Concrete) Mile
0.28 0.5 12 1.68 0.00 M
Trail Maintenance (Native) Mile
0 8 12 0 0.00 M
Trail Maintenance (Granite) Mile
0 4 12 0 0.00 M
Trail Maintenance (Boardwalk) Mile
0 4 12 0 0.00 M
Parking Spaces
0 0.01 12 0 0.00 M
Sign Maintenance Each
0 0.25 12 0 0.00 M
Trash Containers Each
0 0.05 52 0 0.00 M
Litter Control Acre
0 0.5 12 0 0.00 M
Direct Personnel Hours 337.68 0.16
Indirect Personnel Costs and
Hours (Admin,Travel, Preparation,
Repairs, Training) 20%
67.536 0.03
Paid Time Off (Holidays, Vacation,
Sick) 13.85%
46.77 0.02
TOTALS (Direct and Indirect
Personel Hours)
451.98 0.22
LOCATIONS & TASKS
UNIT TOTAL UNITS HRS/UNIT
FREQUENCY
PER YEAR
TOTAL
#HRS # STAFF
PERSONNEL
TYPE
Primitive Camping
Site Maint Each 0 0.17 208 0 0.00 M
Restroom Cleaning/Flush Stalls 6 0.17 208 0.00 C
Mowing Acre 3 0.5 30 0.00 C
Trimming (Edging)1000LF 3 1 30 0.00 C
Tree Trimming Acre 0 16 6 0 0.00 M
Bench Maintenance Each 0 0.5 2 0 0.00 M
Trail Maintenance (Concrete)Mile 0 0.5 12 0 0.00 M
Trail Maintenance (Native)Mile 0 8 12 0 0.00 M
Trail Maintenance (Granite)Mile 0 4 12 0 0.00 M
Parking Spaces 0 0.01 12 0 0.00 M
Sign Maintenance Each 0 0.25 12 0 0.00 M
Trash Containers Each 0 0.05 52 0 0.00 M
Litter Control Acre 0 0.5 12 0 0.00 M
Direct Personnel Hours 0 0.00
Indirect Personnel Costs and
Hours (Admin,Travel, Preparation,
Repairs, Training) 20%
0 0.00
Paid Time Off (Holidays, Vacation,
Sick) 13.85%
0.00 0.00
TOTALS (Direct and Indirect
Personel Hours)
0.00 0.00
LOCATIONS & TASKS UNIT TOTAL UNITS HRS/UNIT FREQUENCY
PER YEAR
TOTAL
#HRS
# STAFF PERSONNEL
TYPE
Maint Facility & Mgr House
Restroom Cleaning/Flush Stalls 2 0.17 0 0.00 C
Mowing Acre 0 0.5 12 0 0.00 C
Trimming (Edging)3000LF 0 1 4 0 0.00 C
Tree Trimming Acre 0 16 6 0 0.00 M
Bench Maintenance Each 0 0.5 2 0 0.00 M
Trail Maintenance (Concrete)Mile 0 0.5 12 0 0.00 M
Trail Maintenance (Granite)Mile 0 4 12 0 0.00 M
Parking Spaces 0 0.01 12 0 0.00 M
Sign Maintenance Each 0 0.25 12 0 0.00 M
Trash Containers Each 0 0.05 52 0 0.00 M
Litter Control Acre 0 0.5 12 0 0.00 M
Direct Personnel Hours 0 0.00
Indirect Personnel Costs and
Hours (Admin,Travel, Preparation,
Repairs, Training) 20%
0 0.00
Paid Time Off (Holidays, Vacation,
Sick) 13.85%
0.00 0.00
TOTALS (Direct and Indirect
Personel Hours)
0.00 0.00
Attachment number 1 \nPage 12 of 13
Item # A
Garey Park
Operations and Maintenance Plan
LOCATIONS & TASKS UNIT TOTAL UNITS HRS/UNIT FREQUENCY
PER YEAR
TOTAL
#HRS
# STAFF PERSONNEL
TYPE
Garey Park (system wide)
Parking Light Maint
Irrigation
Forest Restoration Acre 0 6.25 1 0 0.00 M
Hazardous Tree Removal Each 0 5 1 0 0.00 M
Pest Control Acre 0 2 1 0 0.00 C
Direct Personnel Hours 0 0.00
Indirect Personnel Costs and
Hours (Admin,Travel, Preparation,
Repairs, Training) 20% 0 0.00
Paid Time Off (Holidays, Vacation,
Sick) 13.85%0.00 0.00
TOTALS (Direct and Indirect
Personel Hours)0.00 0.00
Patrol
Foot/Bicycle Acres 0 0.25 52 0 0.00 GPD or Ranger
Motorized Acres 0 0.1 0 0 0.00 GPD or Ranger
Boundary Surveys 1000LF 0 0.25 2 0 0.00 GPD or Ranger
Direct Personnel Costs and Hours 0 0.00
Indirect Personnel Costs and
Hours (Admin,Travel, Preparation,
Repairs, Training) 20% 0 0.00
Paid Time Off (Holidays, Vacation,
Sick) 13.85%0.00 0.00
TOTALS (Direct and Indirect
Personel Hours)0.00 0.00
Totals Per Positions
Park Ranger
Maintenance Personel 6.33
CONTRACTUAL
Mowing Trimming $100,385.00
Pond Maint Event Area Acres 3.1 48 $7,500.00
Pest Controlg
Maintenance $124,425.00
Event Center Custodial $26,000.00
Personnel Key: O = office M = Maintenance C = Contractual/Custodial
Attachment number 1 \nPage 13 of 13
Item # A
3.24.15
Item No. Item Description Quantity Unit Unit Price Total Price Running Total
PARK ENTRIES|GATE HOUSE | PRIMARY PARK ENTRY ROAD $1,127,800.00
1 Primary Entry (masonry signs, fencing, landscape/drip irrigation)1 LS 60,000.00 60,000.00
2 Secondary Entry (masonry signs, fencing, landscape/drip irrigation) 1 LS 40,000.00 40,000.00
3 Gate House 400 SF 182.00 72,800.00
4 Gate House Site Allowance (gates, walls, landscape/drip irrigation) 1 LS 30,000.00 30,000.00
5 Gate House Wet Utilities Allowance (septic/domestic water) 1 LS 15,000.00 15,000.00
6 Weathed Steel Roadside Guardfence 3,500 LF 50.00 175,000.00
7 Roadway-Entry to gate house to active rec. to secondary entry (24 ft. average width, paved asphalt) 16,800 SY 35.00 588,000.00
8 Misc.Roadway Allowance (stripping, signage, drainage appurtenances) 1 LS 147,000.00 147,000.00
EQUESTRIAN FACILITIES $2,179,210.00
EQUESTRIAN PAVILION SUBTOTAL $438,540.00
1 Equestrian Pavilion Toilets 1,122 SF 210.00 235,620.00
2 Equestrian Pavilion Covered Area 2,838 SF 70.00 198,660.00
3 Equestrian Pavilion Tie Rails 64 LF 40.00 2,560.00
4 Equestrian Pavilion Stone Benches (2)2 EA 600.00 1,200.00
5 Equestrian Pavilion Signage Allowance 1 EA 500.00 500.00
EQUESTRIAN COVERED ARENA SUBTOTAL $1,153,300.00
1 Covered Arena Structure (incl. lighting/electrical) (assuming pre-engineered steel building package)25,520 SF 40.00 1,020,800.00 Added to orignal scope/budget
2 Covered Arena Stone Column Enclosures (18 @ 140sf EA) 2,520 SF 25.00 63,000.00 Added to orignal scope/budget
3 Covered Arena Steel Pipe Rails & Gates 600 LF 40.00 24,000.00
3 Covered Arena Compacted Clay Sub Base 18,000 SF 1.00 18,000.00
4 Covered Arena Equestrian Footing (dirt/sand cushion) 18,000 SF 1.50 27,000.00
5 Covered Arena Signage Allowance 1 EA 500.00 500.00
SHADED HORSE PENS (5)SUBTOTAL $69,400.00
1 Shade Structures (5 @ 10'x20')1,000 SF 48.00 48,000.00
2 Steel Pipe Rails & Gates 340 LF 40.00 13,600.00
3 Limestone Screenings at Pens 2,600 SF 3.00 7,800.00
EQUESTRIAN TRAILHEAD SITE CONSTRUCTION SUBTOTAL $517,970.00
1 12' Diameter Windmill with 40' Tower Allowance (by Aermotor Windmill Co. San Angelo, TX)1 EA 18,190.00 18,190.00
2 Horse Wash Area Tie Rail 32 LF 40.00 1,280.00
3 Horse Wash Area Trench Drain to daylight (allowance) 1 EA 800.00 800.00
4 Stone Retaining Walls Allowance 1,820 SF 35.00 63,700.00
5 Water Feature Allowance (2) (CIP concrete, waterproofing, pumps, plumbing) 2 EA 30,000.00 60,000.00
6 Stone Paver Walkways 14,000 SF 8.00 112,000.00
7 Weather Steel Roadside Guardfence 1,200 LF 55.00 66,000.00
8 Compacted Limestone Parking/Walkways 9,000 SY 18.00 162,000.00
9 Paved Parking (asphalt)200 SY 35.00 7,000.00
10 Misc.Roadway Allowance (stripping, signage, etc.) 1 LS 2,000.00 2,000.00
11 Wet Utilities Allowance (septic/domestic water)1 LS 25,000.00 25,000.00
GAREY PLAY RANCH $1,815,000.00
1 Play Equipment Allowance 1 LS 500,000.00 500,000.00
2 Play Surfacing Allowance 1 LS 180,000.00 180,000.00
3 Splash Pad (including pumps and covered enclosure) 1 L 350,000.00 350,000.00
4 Large Group Pavilion (50x75)1EA 150,000.00 150,000.00
5 Small Pavilion (25x50)3EA 50,000.00 150,000.00
6 Heritage of Gold Pavilion (25x50)1EA 75,000.00 75,000.00
7 Restroom (type2)1EA 125,000.00 125,000.00
8 Wet Utilities Allowance (septic/domestic water)1 LS 25,000.00 25,000.00
9 Walkway Allowance 1 LS 60,000.00 60,000.00
10 Fencing Allowance 1 LS 50,000.00 50,000.00
11 Furnishing Allowance (Picnic Tables, trash recepticles, etc.) 1 LS 75,000.00 75,000.00
11 Landscape/Drip Irrigation Allowance 1 LS 50,000.00 50,000.00
12 Misc. Site Work Allowance 1 LS 25,000.00 25,000.00
GAREY DOG RANCH $220,000.00
1 Covered Entry (10x20)1 LS 20,000.00 20,000.00
2 Small Pavilion (20x20)3EA 20,000.00 60,000.00
3 Walkway Allowance 1 LS 40,000.00 40,000.00
4 Fencing Allowance ( Including gates)1 LS 65,000.00 65,000.00
5 Agility Area Lawn/Irrigation Allowance (approx. 1/2 acre) 1 LS 10,000.00 10,000.00
6 Misc. Waste Disposal, etc..1 LS 5,000.00 5,000.00
7 Washdown Area (including wet utilities, sump drain) 1 EA 20,000.00 20,000.00
OPEN PLAY FIELD $25,000.00
1 Site Work (Regrade)1 LS 10,000.00 10,000.00
2 Reveg/Irrigation 1 LS 15,000.00 15,000.00
ACTIVE RECREATION PARKING $324,000.00
1 Paved Parking (asphalt)7,000 SY 35.00 245,000.00
2 Landscape/Drip Irrigation/Bioswale Allowance 1 LS 75,000.00 75,000.00
3 Misc. Roadway Allowance (stripping, signage, etc.) 1 LS 4,000.00 4,000.00
EVENT AREA | MEADOW |DAY USE $1,950,000.00
1 Garey House Interior Improvement Allowance (does not include furnishings)1 LS 130,000.00 130,000.00
2 Garey Exterior Walkways/Patio/Dance Floor/Bandstand/Reception Area Allowance 1 LS 100,000.00 100,000.00
3 Garey House Landscape/IrrigationAllowance 1 LS 75,000.00 75,000.00
4 Wet Utilities Allowance (septic expansion)1 LS 20,000.00 20,000.00
5 The Forum/Amphitheater Allowance 1 LS 200,000.00 200,000.00
6 Amphitheater Restroom (type 2)1 LS 125,000.00 125,000.00
7 Meadow/Parking Lot - Landscape/Irrigation Allowance 1 LS 125,000.00 125,000.00
7 Wet Utilities Allowance (septic/domestic water)1 LS 25,000.00 25,000.00
8 Paved Parking (asphalt)11,000 SY 35.00 385,000.00
9 Roadway-one way loop from gatehouse to house to equestrian are (14 ft. average width, paved asphalt) 9,500 SY 35.00 332,500.00
10 Roadway-one way loop around event center (14 ft. avg. width, paved asphalt) 3,500 SY 35.00 122,500.00
11 Misc.Roadway Allowance (stripping, signage, drainage appurtenances) 1 LS 210,000.00 210,000.00
12 Meadow/Parking Lot - Landscape/Irrigation Allowance (Allee, etc..) 1 LS 100,000.00 100,000.00
RETREAT CAMPING $1,340,000.00
1 Retreat Cabin (900 sf)9 EA 110,000.00 990,000.00
2 Wet Utilities Allowance (septic/domestic water)1 LS 100,000.00 100,000.00
3 Fireplace/Pit 1 LS 30,000.00 30,000.00
4 Walkway Allowance 1 LS 45,000.00 45,000.00
5 Paved Parking/Roadway (asphalt)5,000 SY 35.00 175,000.00
GROUP CAMPING $1,070,000.00
1 Group Cabin (900 sf)8 EA 80,000.00 640,000.00
2 Restroom/Shower (type 3)1 LS 170,000.00 170,000.00
2 Wet Utilities Allowance (septic/domestic water)1 LS 50,000.00 50,000.00
3 Fireplace/Pit 1 LS 30,000.00 30,000.00
4 Walkway Allowance 1 LS 40,000.00 40,000.00
5 Paved Parking/Roadway (asphalt)4,000 SY 35.00 140,000.00
PRIMITIVE CAMPING (Shared Parking with Day Use)$172,500.00
1 Primitive Site Allowance (timber/decomposed granite tent pads, latten hooks) 11 EA 2,500.00 27,500.00
2 Restroom (type 1)1 LS 100,000.00 100,000.00
3 Wet Utilities Allowance (septic/domestic water)1 LS 25,000.00 25,000.00
4 Trail Allowance 1 LS 20,000.00 20,000.00
MAINTENANCE FACILITY | HOST HOUSE $650,000.00
1 Maintenance building, parking, office, fencing allowance 1 LS 450,000.00 450,000.00
2 Host House 1 LS 175,000.00 175,000.00
3 Wet Utilities Allowance (septic/domestic water)1 LS 25,000.00 25,000.00
SUBTOTAL $10,873,510
OTHER PROJECT COSTS $2,174,702.0
Construction Contingency (Gen. Conditions, Misc. Site Work, Dry Utilities, Wet Utilities to use areas, E/S
controls, Equestrian and Pedestrian Trails, etc.)1 LS 20%
TOTAL SCHEMATIC DESIGN WITH CONTINGENCY $13,048,212
Assumptions/Disclaimers:
3) Professional Design Service fees are not included with this OPCC (i.e.- landscape architectural, civil, architectural, structural, MEP, etc.-design, permitting, bidding and construction observation services)
6) Projection of future construction costs should include a 10% annual increase at a minimum.
Garey Park - OPCC (100% SDs)
1) All Opinion of Probable Construction Costs(OPCC) represent the Consultant and their Sub-Consultant(s) best judgement as professionals, familiar with the construction industry and current available unit pricing;
Consultant/Sub-Consultant(s) do not guarantee that proposals, bids or actual project costs will not vary from its Opinion of Probable Construction Costs. Quantities are estimates only and the actual amount of work
and/or materials are contingent upon final design of these facilities.
2) Unit pricing is based on average cost statewide and do not account for any site specific determinates that would effect costs of constuction (i.e.- unknown
subsurface conditions, etc.)
4) Horizontal utility adjustments/relocations/extensions/services for storm sewer, domestic water, sanitary sewer, gas, electric and communication utility lines to site are not included
in this OPCC.
5) Roadway improvements on FM2243/Leander Rd. are not included in this OPCC other than minimal work required for driveway and trail tie-in installation.
Page 1 of 1
Attachment number 2 \nPage 1 of 1
Item # A
City of Georgetown, Texas
City Council Agenda
March 24, 2015
SUBJECT:
Discussion on proposed amendments to the Unified Development Code (UDC) relating to the development
standards, rules, and procedures that affect properties located in a Historic Overlay District and/or listed on
the Historic Resource Survey -- Matt Synatschk, Historic Planner, Andreina Davila-Quintero, Project
Coordinator and Laurie Brewer, Assistant City Manager
ITEM SUMMARY:
At the February 10, 2015 City Council meeting, City staff presented First Reading of the Ordinance for
proposed changes to the Unified Development Code (UDC) relating to the development standards, rules, and
procedures that affect properties located in a Historic Overlay District and/or listed on the Historic Resource
Survey (EXHIBIT D). Following the public hearing, the City Council postponed First Reading of the
Ordinance to the first meeting in April, and directed staff to conduct additional workshops with the
stakeholders prior to this date. The purpose of these workshops was to give the stakeholders additional
opportunity to review the proposed amendments and submit their comments to staff.
City staff hosted two workshops: the first on February 26, 2015, with the Historic and Architectural Review
Commission (HARC); and the second on March 12, 2015, with property and business owners and other
interested members of the public (approximately 25-30 people were in attendance). The workshops were
structured into four major topics of discussion based on the majority of the comments and concerns
previously received. A complete list of all public comments received, to include new comments from the
February 10, 2015 City Council meeting (highlighted in blue), are attached as EXHIBIT B.
The four major areas of discussion at the follow-up workshops, along with the summarized comments, were
(in the order as it appears in the UDC):
1) Public Notification (Chapter 3; Section 3.03)
The proposed UDC amendment revises the public notification process to only apply to those applications that
must be considered by the HARC. Administrative Certificate of Appropriateness (CoA) will be reviewed in
accordance with clear/defined standards and guidelines consistent with other administrative application
processes. City staff received mixed comments on the proposed public notification process. Some of the
comments stated that public notification should be required for all applications; others commented that the
CoA process should not require as much notification as the UDC identifies specific activities and
development that are permitted by right and thus do not need notification. Staff also received comments
about making information available regarding application statuses online and/or through email notification.
No changes were made to the proposed UDC amendments relating to the public notification process.
However, staff can look at administrative processes to communicate to the HARC and public the outcome of
Administrative CoAs, such as providing a report to the HARC at their regularly scheduled meeting.
2) Historic Landmark Designation (Chapter 3; Section 3.06.070)
The proposed amendments include a new designation, Historic Landmarks, that would include local
buildings, structures or sites, designated via ordinance, that are considered the City's highest priority historic
resources. The majority of the comments received were in support of this new designation; however, some
concerns were expressed particularly as the City has not yet identified specific structures that may be eligible
for this designation. Other comments included clarification on the designation process, and what criteria will
be used to determine eligibility for designation.
Section 3.06.070, Criteria for Approval for a Historic Landmark designation, was revised to clarify the
findings required to meet this criteria, highlighted in yellow (EXHIBIT A). No other changes were made to
the proposed amendments relating to the designation of local Historic Landmarks.
3) Review Authority for Certificate of Appropriateness (Chapter 3; Table 3.13.010 and Section 3.13.010.B)
The proposed amendments break-down the review authority based on the project (scope of work), and the
Cover Memo
Item # B
type of structure (contributing vs. non-contributing historic structure, and Historic Landmarks) in order to
provide clarity on the level of review required for a specific project. Comments received by the stakeholders
ranged from decreasing the amount of projects that require review and approval by the HARC (more
administrative review); to eliminating all Historic Preservation Officer (HPO) authority (all applications
should be approved by the HARC); to requiring some level of review (whether by the HARC or HPO) for all
structures regardless of its (non)historic significance.
Table 3.13.010 was revised to include some projects where staff agreed that further review was needed either
by the HARC or HPO to ensure that the historic significance of the structure and/or district was preserved. A
summary of the proposed changes in Review Authority are outlined in EXHIBIT C.
4) Requests for Relocation, Removal or Demolition (Chapter 3; Table 3.13.010 and Section 3.13.030.E)
The proposed amendments clarify the demolition process to only apply to structures that are of historic
significance to the City, whether as a stand-alone structure or located within a Historic Overlay District. In
addition, it clarifies what is considered to be removal of a feature versus actual demolition, and establishes a
threshold for minor demolitions or relocations that may be reviewed administratively. Comments received
ranged from any demolition, in whole or in part, of any structure (historic and non-historic) should be
reviewed by the HARC or HPO; to the demolition or relocation process should not apply to non-historic
structures; to all demolitions of a historic structure (regardless of the size) should be reviewed by the HARC.
In addition, a comment was also received that the demolition review process should apply to all structures
that are eligible to be designated as a Historic Landmark to provide the opportunity for additional review and
determination of whether or not the structure should be designated as a local Historic Landmark, and thus
preserved.
Table 3.13.010 was revised to require approval by the HARC for the removal of an awning or canopy from a
historic contributing structure, and to reduce the threshold of what triggers a demolition request to be
reviewed by the HARC from thirty percent (30%) to fifteen percent (15%). No other changes were made to
the proposed amendments relating to the relocation, removal or demolition process.
Other Changes:
Other minor changes to the UDC include the following:
Chapter 3, Section 3.06.060, Criteria for Approval for a Historic Overlay District, was revised to
clarify the findings required to meet this criteria.
Chapter 3, Section 3.13.010.A was revised to clarify that each portion of a project (scope of work)
will be subject to the review process and criteria for approval for that portion of the project.
Chapter 3, Section 3.13.020.A.4.b was revised to clarify that requests forwarded to the HARC will be
subject to public notification.
Chapter 16, Section 16.02, definitions of historic structures, contributing and non-contributing, were
revised to include the 1984 and 2007 Historic Resource Surveys.
Other changes included new or revised language for clarification purposes (Chapter 3).
All new revisions and changes from the previous draft of proposed amendments are highlighted in yellow in
the attached Revised Proposed UDC Amendment (EXHIBIT A).
Next Steps:
The next dates in the UDC amendment process are:
April 14, 2015 – City Council Meeting, First Reading of the Ordinance
April 28, 2015 – City Council Meeting, Second Reading of the Ordinance
A summary of the Project Timeline is included as EXHIBIT E.
FINANCIAL IMPACT:
N/A
SUBMITTED BY:
Matt Synatschk, Historic Planner, Andreina Davila-Quintero, Project Coordinator, and Laurie Brewer,
Cover Memo
Item # B
Assistant City Manager
ATTACHMENTS:
Exhibit A - Revised Proposed UDC Amendments
Exhibit B - Updated Summary of Public Comments
Exhibit C - Revised Proposed Approval Authority Comparison Table
Exhibit D - February 10, 2015 City Council Agenda Item R Cover Sheet
Exhibit E - Project Timeline
Cover Memo
Item # B
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria policies to guide improvements to properties and work within the
Downtown Overlay District, and Old Town Overlay District, and Historic Overlay District.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 1 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 1 of 50
Item # B
Chapter 2 Review Authority
Section 2.01 General
2.01.020 Summary of Review Authority
The following Table summarizes the decision-making authority of each review body for the City of
Georgetown.
Table 2.01.020: Summary of Review Authority
Procedure
Pl
a
n
n
i
n
g
Di
r
e
c
t
o
r
Bu
i
l
d
i
n
g
Of
f
i
c
i
a
l
De
v
e
l
o
p
.
En
g
i
n
e
e
r
Ur
b
a
n
Fo
r
e
s
t
e
r
Hi
s
t
o
r
i
c
Pr
e
s
e
r
v
a
t
i
o
n
Of
f
i
c
e
r
HA
R
C
ZB
A
P&
Z
Ci
t
y
C
o
u
n
c
i
l
City Council Action
Access Point Connection Exemption R R R <DM>
Annexation R <DM>
Comprehensive Plan Amendment R <R> <DM>
Conservation Subdivision/Site Analysis Map R R DM
Development Agreement R <R> <DM>
Historic Overlay District Designation R R <R> <R> <DM>
Historic Landmark Designation R <R> <DM>
Rezoning (Zoning Map Amendment) R <R> <DM>
Special Use Permit R <R> <DM>
UDC Text Amendment R <R> <DM>
Administrative Action
Administrative Exception DM A A*
Administrative Plat (minor or amend plat) DM R A
Administrative Certificate of Design
Compliance AdministrativeAppropriateness DM DM A
Construction Plans DM A
Courthouse View Height Determination DM A
Driveway Permit DM A
Final Plat DM R A
Heritage Tree Protection Priority DM R R A
Heritage Tree Pruning Permit A DM
Heritage Tree Removal DM A
License to Encroach DM A
Master Sign Plan DM A
Sign Permit DM A
Site Plan DM R A
Stormwater Permit DM A
Temporary Use Permit DM A
Traffic Impact Analysis DM A
Historic and Architectural Review Commission (HARC) Action
Certificate of Design
ComplianceAppropriateness R R <DM> A
EXHIBIT A - Revised Proposed Changes to the UDC
Page 2 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 2 of 50
Item # B
Procedure
Pl
a
n
n
i
n
g
Di
r
e
c
t
o
r
Bu
i
l
d
i
n
g
Of
f
i
c
i
a
l
De
v
e
l
o
p
.
En
g
i
n
e
e
r
Ur
b
a
n
Fo
r
e
s
t
e
r
Hi
s
t
o
r
i
c
Pr
e
s
e
r
v
a
t
i
o
n
Of
f
i
c
e
r
HA
R
C
ZB
A
P&
Z
Ci
t
y
C
o
u
n
c
i
l
HARC Exception (Building Height/ Setback
variations pursuant to Section
4.08/Alternative Parking Plan)
R R <DM> A
Heritage Tree Protection Priority R R R DM A
Master Sign Plan R R <DM> A
Zoning Board of Adjustment (ZBA) Action
Appeal of Administrative Decision <DM>
Special Exception R <DM>
Variance <DM>
Planning and Zoning Commission
Heritage Tree Protection Priority R R R DM A
Minor or Final Plat w/Waiver R R DM A
Plat Waiver R R DM A
Preliminary Plat R R DM A
Variance (floodplain & stormwater) <DM>
Variance [water quality regulations
(Section 11.07.003)]
R <DM> A
R – Review or Recommendation DM – Decision Making Authority A – Appeal Authority
< > - Public Hearing * Administrative Exceptions related to Chapter 8 items are sent to the City Council, all others are
appealed to ZBA.
Section 2.02 Administrative Officials
2.02.010 Director of Planning and Development Department (Director)
B. Powers and Duties
The Director of Planning and Development Department has the following powers and duties:
1. Final Action
The Director is responsible for taking final action on the following procedures described in
this Code, subject to the specific criteria for each procedure as described in the Code.
a. Administrative Exceptions
b. Administrative Plats
c. Final Plats
d. Site Plans
2. Review and Report
The Director shall review and make either a report or recommendation to the Historic and
Architectural Review Commission, Zoning Board of Adjustment, Planning & Zoning
Commission, or City Council on the following procedures, subject to the terms and
conditions set forth for such procedures in this Code.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 3 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 3 of 50
Item # B
a. Access Point Connection Exemption
b. Certificate of Design Compliance
cb. Comprehensive Plan Amendment
dc. Development Agreement
ed. Historic Overlay District Designation
fe. Preliminary Plat
gf. Rezoning (Zoning Map Amendment)
hg. Special Exception
ih. Special Use Permit
ji. Unified Development Code Text Amendment
kj. Variance
3. Additional Duties
The Director shall have the following additional duties:
a. To comply with any other duty or responsibility clearly assigned to the Director
elsewhere in this Code;
b. To ensure conformance with all provisions of this Code;
c. To meet with potential applicants in Pre-application Conferences as described in this
Code; and
d. To act and serve as staff for each review body appointed by this Code; and.
e. To act and serve as the City’s Historic Preservation Officer and coordinate the City’s
various efforts and programs furthering historic preservation.
4. Delegation
The Director may delegate any duties to members of the Planning and Development
Department staff. Such designation authorizes the staff member to act on the Director’s
behalf, but does not relieve the Director of overall responsibility for any final action, report,
recommendation or additional duty described in this Code.
2.02.060 Historic Preservation Officer
A. Designation
The Director may designate a Historic Preservation Officer to function as described in this Code.
B. Powers and Duties
The duties of the Historic Preservation Officer shall include, but are not limited to:
1. Providing review, report and recommendation to the Historic and Architectural Review
Commission (HARC) regarding Certificates of Appropriateness and any other provisions of
this Code requiring action by HARC;
2. Reviewing and taking final action on Administrative Certificates of Appropriateness;
EXHIBIT A - Revised Proposed Changes to the UDC
Page 4 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 4 of 50
Item # B
3. Reviewing and taking final action on Alternative Parking Plans in a Historic Overlay
District; and
4. Coordinating local historic preservation efforts with the State Historic Preservation Office
(SHPO), the National Park Service (NPS), and the Advisory Council on Historic Preservation
(ACHP) in compliance with the National Historic Preservation Act of 1966, as amended,
TAC Chapter 15.6, as amended and any additional federal and state enabling legislation.
Section 2.03 Historic & Architectural Review Commission (HARC)
2.03.010 Powers and Duties
The Historic and Architectural Review Commission (HARC) has the following powers and duties as
described in this Code:
A. Final Action
The HARC shall be responsible for hearing and taking final action on the following procedures
described in this Code:
1. Certificate of Appropriatenessof Design Compliance; and
2. HARC Exceptions ons (Building Height and Setback variations pursuant to Section 4.08. of
this Code020 and an Alternative Parking Plan pursuant to Section 9.02.050); and.
3. Heritage Tree Protection Priority pursuant to Section 8.02.050.B
3. Hear and take final action on an appeal of an Administrative Certificate of Appropriateness.
B. Review and Recommendation
The HARC shall review and make recommendations to the City Council on the designation of
Historic Overlay Districts and Historic Landmark Designations, subject to the terms and
conditions set forth for the procedure in this Code.
C. Additional Duties
The HARC has the following additional duties:
1. To act and assist the City Council in formulating design guidelines and other supplemental
materials relevant to historic preservation or design review; and
2. To render advice and guidance, upon request of the property owner or occupant, on new
construction or the restoration, alteration, or maintenance of any historic resource building
or structure or other building within the Downtown, Old Town, anda Historic Overlay
Districts or designated as a Historic Landmark.; and
3. Hear and decide an appeal of an Administrative Certificate of Design Compliance.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 5 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 5 of 50
Item # B
Chapter 3 Applications and Permits
Section 3.01 General
3.01.020 Applicability of Procedures
The following Table shows which review procedures, applications and permits apply in the City and
its extraterritorial jurisdiction.
Table 3.01.020 Applicability of Procedures
City Limits Extraterritorial Jurisdiction
Prior to Subdivision, Platting and any Development
Comprehensive Plan Amendment X X
UDC Text Amendment X X
Rezoning (Zoning Map Amendment) X
Historic Overlay District Designation X
Historic Landmark Designation X
Special Use Permit X
Development Agreement X X
Access Point Connection Exemption X X
Subdivision & Platting of Land
Recording Plats X X
Preliminary Plat X X
Construction Plans X X
Plat Vacation X X
Plat Waiver X X
Development Application Process
Site Plan X
Construction Plans X
Zoning Verification Letter X
Legal Lot Verification Letter X X
Temporary Use Permit X
Master Sign Plan X X
Certificate of Design Compliance
Appropriateness X
Appeal of an Administrative Decision X X
License to Encroach X X
Variance X
Administrative Exception X
Special Exception X
Stormwater Permit X X
Driveway Permit X X
Sign Permit X X
Courthouse View Height Determination X
3.01.030 Simultaneous Submission of Related Applications
A. Submission of different applications related to the same development may be made
simultaneously, although consideration of applications must remain in the following sequence:
EXHIBIT A - Revised Proposed Changes to the UDC
Page 6 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 6 of 50
Item # B
1. Comprehensive Plan;
2. Zoning;
3. Subdivision and Plat;
4. Certificate of Design ComplianceAppropriateness; then
5. Site Plan.
B. Any application submitted simultaneously is subject to approval of all other related
applications. Denial or disapproval of any concurrently submitted application shall stop
consideration of any related applications.
C. An applicant may withdraw any individual application from a group of simultaneously
submitted applications.
Section 3.02 Common Review Elements
3.02.010 Pre-application Conference
Prior to the submission of an application required by this Code, a Pre-application Conference with
the Director shall be required as follows.
A. A Pre-application Conference is a meeting between a potential applicant under this Code and
the Director of Planning and Development Department or a designated representative. The
conference is an opportunity for an applicant to describe what application is being considered,
and the Director to indicate which application is appropriate, which review body is responsible
for final action, and what criteria will be used to determine whether the permit should be
approved.
B. There is no required format for a Pre-application Conference; it may occur in any form so long
as the potential applicant receives the information described above. The applicant is responsible
for completing a Pre-application Conference, and must sign a Pre-application Statement
indicating the date of the Pre-application Meeting.
C. A Pre-application Conference is required for the following applications:
• Access Point Connection Exemption
• Administrative Exception
• Annexation (Voluntary)
• Certificate of Design Compliance Appropriateness
• Comprehensive Plan Amendment
• Conservation Subdivision Site Analysis Map
• Construction Plans
• Courthouse View Height Determination
• Development Agreement
• Driveway Permit
• Historic Overlay District Designation
EXHIBIT A - Revised Proposed Changes to the UDC
Page 7 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 7 of 50
Item # B
• Historic Landmark Designation
• License to Encroach
• Master Sign Plan
• Planned Unit Development
• Plat Waiver
• Plat Vacation
• Rezoning (Zoning Map Amendment)
• Site Plan
• Special Exception
• Special Use Permit
• Stormwater Permit
• Subdivision Plats - All
• Temporary Use Permit
• Unified Development Code Text Amendment
• Variance
D. Pre-application Conferences may be combined when an applicant will be making simultaneous
applications for the same project.
E. Completion of a Pre-application Conference does not imply or assume subsequent approval of
the permit or application.
Section 3.03 Public Hearing and Notice
3.03.010 Provision of Public Notice
A. Summary of Notice Required
Notice shall be required for application review as shown in the following Table.
Table 3.03.010: Summary of Notice Requirements
Procedure Published Mailed Posted
Access Point Connection Exemption X X X
Certificate of Design Compliance
Appropriateness X‡
Certificate of Appropriateness for relocation,
removal or demolition, or setback
modification
‡ ‡
Development Agreement * * *
Historic Overlay District Designation X X X
Historic Landmark Designation X X X
EXHIBIT A - Revised Proposed Changes to the UDC
Page 8 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 8 of 50
Item # B
Replat without Vacating (§212.0145) X X
Rezoning (Zoning Map Amendment) X X X
Special Exception X X X
Special Use Permit X X X
UDC Text Amendment X
Variance X X X
X = Notice Required
* = Notice to be determined by Development Agreement Committee per Section 3.20
‡ = Only applicable to Certificate of Appropriateness applications that require
consideration by the Historic and Architectural Review Commission
B. Published Notice
1. A Public Notice shall be published at least once in a local newspaper of general circulation,
as designated by the City Council, within the City prior to the meeting. The Notice shall
contain the time and place of such Public Meeting or Hearing and a brief description of the
agenda items that may be considered or reviewed.
2. A published notice shall be published at least 15 days in advance of the Public Meeting or
Hearing.
C. Mailed Notice
1. Generally
A Notice of Public Hearing shall be sent by U.S. mail to owners of record of real property
within 200 feet of the boundary of the property under consideration, as determined by the
most recent municipal tax roll information. The notice may be served by its deposit in the
municipality, properly addressed with postage paid, in United States mail at least 15 days
prior to the date set for the Public Hearing or as otherwise required by the Texas Local
Government Code, as amended.
2. Special Mailed Notice Required for Certain Replats
Replats containing any area or lot that, during the preceding five years, was limited by an
interim or permanent zoning classification to residential use for not more than two
residential units per lot or in the preceding plat was limited by deed restrictions to
residential use for not more than two residential units per lot, require mailed notice to all
owners of lots that are part of the original subdivision and located within 200 feet of the
boundary of the property to be replatted, in the same manner as prescribed in Section
3.03.010.C.1 above and in accordance with §212.015 of the Texas Local Government Code,
as amended.
3. Special Mailed Notice Required for Special Exception for Setback Modification
In addition to the requirements of Section 3.03.010.C.1 above, mailed notice shall also be
provided to all owners of property within the subject block in which the property under
consideration for Special Exception for Setback Modification is located.
4.3. Special Mailed Notice Required for PUD Modification
a. For purposes of mailed notice, the boundary of a PUD Modification shall be the
boundary of any tract of land for which PUD standards or requirements are proposed
to change due to the modification.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 9 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 9 of 50
Item # B
b. In addition to the requirements of Paragraph 1 above, mailed notice shall also be
provided all owners of property within the entire PUD boundary, not otherwise
notified.
D. Posted Notice
1. Notice shall be posted in a format approved by the Director on the subject property, along
rights-of-way contiguous to the proposed development according to the following
standards:
a. One sign for tracts of less than 300 feet of right-of-way frontage;
b. One sign at each interval of 1,000 feet; and
c. The total number of signs shall not be required to exceed a total of four signs per right-
of-way.
2. Notice of application for a Certificate of Design Compliance shall be posted at the project
site such that it is visible from the public right-of-way, including contact information and
meeting date. For Certificates of Design Compliance processed administratively, the notice
shall provide contact information and the expected date of decision.
3. The applicant shall be responsible for posting and maintaining the sign on a format
approved by the Director, and for removing the sign within five days following the Public
Hearing on the application.
4. Posted notice shall be posted not less than 15 days prior to the scheduled Public Hearing.
E. Content of Notice
Published or mailed notices shall contain at least the following specific information:
1. The general location of land that is the subject of the application, including a location map
with the mailed notice only;
2. The legal description or street address;
3. The substance of the application, including the type of proposed development and the
current Zoning District;
4. The time, date, and location of the Public Hearing;
5. A phone number to contact the City; and
6. A statement that interested parties may appear at the Public Hearing.
F. Constructive Notice
Minor defects in notice shall not impair the notice or invalidate proceedings pursuant to the
notice if a bona fide attempt has been made to comply with applicable notice requirements.
3.03.020 Required Public Hearing
The following Table identifies the types of applications requiring a Public Hearing and the review
body responsible for conducting the Hearing.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 10 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 10 of 50
Item # B
Table 3.03.020: Summary of Required Public Hearing
Type of Application HARC Zoning Board
of Adjustment
Planning &
Zoning
City
Council
Access Point Connection Exemption X
Appeal of Admin. Decision X
Certificate of Design Compliance
Appropriateness
X‡
Comprehensive Plan Amendment X X
Development Agreement * X
Historic Overlay District Designation X X X
Historic Landmark Designation X X
Replat (Resubdivision) X X
Rezoning (Zoning Map Amendment) X X
Special Exception X
Special Use Permit X X
UDC Text Amendment X X
Variance X
X = Public Hearing Required
* = Public Hearing to be determined by Development Agreement Committee per Section 3.20
‡ = Only applicable to Certificate of Appropriateness applications that require consideration by the
Historic and Architectural Review Commission
Section 3.06 Zoning Map Amendment – Rezoning
3.06.010 Applicability
For the purpose of establishing and maintaining sound, stable, and desirable development within the
territorial limits of the City, the Official Zoning Map may be amended based upon changed or
changing conditions in a particular area, or in the City generally, or to rezone an area or extend the
boundary of an existing Zoning District or Overlay District. All amendments must be consistent with
the Comprehensive Plan. The provisions of the Section related to rezoning are adopted pursuant to
Texas Local Government Code Chapter 211 and the City Charter.
3.06.020 Review Process
A. Initiation
Initiation of a map amendment may be made upon:
1. Application of a property owner or their designated agent;
2. Recommendation of the City Council;
3. Recommendation of the Planning & Zoning Commission; or
4. For a Historic Landmark or Historic Overlay District designation, recommendation of the
Historic and Architectural Review Commission; or
5. Recommendation of the Director.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 11 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 11 of 50
Item # B
B. Application and Completeness Determination
The Director is responsible for checking that a complete application has been submitted with all
material necessary for the City Council to render an informed decision.
C. Staff Review
1. The Director shall review the application, considering any applicable criteria for approval
and prepare a report to the Planning & Zoning Commission, the Historic and Architectural
Review Commission (where applicable), and City Council.
2. The Director may establish procedures for administrative review necessary to ensure
compliance with this Code and state statutes.
3. The Director may assign staff to review the application and make a report to the Director.
4. The Director’s report may include a recommendation for final action.
D. Historic and Architectural Review Commission
When a request is made for Historic Landmark or Historic Overlay District designation, the
Commission shall hold a Public Hearing in accordance with its rules and state law, and make a
recommendation to the City Council following notice in accordance with Section 3.03.
DE. Planning &
Zoning Commission Review
Following notice in accordance with Section 3.03, the Commission shall hold a Public Hearing
in accordance with its rules and state law and make a recommendation to the City Council.
Designation of a Historic Landmark shall not require review and recommendation by the
Planning and Zoning Commission.
F. City Council Final Action
1. The City Council shall hold a Public Hearing and may take final action on the proposed
amendment.
2. The amendment shall become effective when approved by the City Council and in
accordance with the City Charter. If a proposed amendment has been recommended for
disapproval by the Planning & Zoning Commission or and the Historic and Architectural
Review Commission (where applicable) the amendment may not become effective except
by a three-fourths vote of all members of the City Council.
3.06.030 Approval Criteria (Rezoning)
The City Council shall consider the following approval criteria for zoning changes:
A. The application is complete and the information contained within the application is sufficient
and correct enough to allow adequate review and final action;
B. The zoning change is consistent with the Comprehensive Plan;
C. The zoning change promotes the health, safety or general welfare of the City and the safe
orderly, and healthful development of the City;
D. The zoning change is compatible with the present zoning and conforming uses of nearby
property and with the character of the neighborhood; and
EXHIBIT A - Revised Proposed Changes to the UDC
Page 12 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 12 of 50
Item # B
E. The property to be rezoned is suitable for uses permitted by the District that would be applied
by the proposed amendment.
3.06.040 Approval Criteria (Planned Unit Development)
In addition to the zoning change criteria above, the City Council shall consider the following specific
objectives and criteria for approving the PUD.
A. Specific Objectives
Rezoning to and development under the PUD District will be permitted only in accordance
with the following specific objectives:
1. A variety of housing types, employment opportunities, or commercial services to achieve a
balanced community;
2. An orderly and creative arrangement of all land uses with respect to each other and to the
entire community;
3. A planned and integrated comprehensive transportation system providing for a separation
of pedestrian and vehicular traffic, to include facilities such as roadways, bicycle ways, and
pedestrian walkways;
4. The provisions of cultural or recreational facilities for all segments of the community;
5. The location of general building envelopes to take maximum advantage of the natural and
manmade environment; and
6. The staging of development in a manner which can be accommodated by the timely
provision of public utilities, facilities, and services.
3.06.050 Approval Criteria (Overlay Districts) - Reserved.
3.06.060 Approval Criteria (Historic Overlay Districts Designation)
A. In addition to
the approval criteria for zoning changes abovein Section 3.06.030, the City Council shall consider
make the findings that one or more of the following criteria for approving a Historic Overlay District
is met:
1.A. Character, interest, or value of the structures, sites or area because of its their unique role
in the development, heritage or cultural characteristics of the Ccity of Georgetown, county,
Sstate of Texas or nation;
2.B. Occurrence of a notable historical event at the structures, sites, or area;
3.C. Identification of the structures, sites, or area with a person or persons who contributed
notably to the culture and development of the city, county, state, or nation, or society;
4.D. Embodiment in multiple buildings in a structure or site or area under consideration of
distinctive elements of architectural design, detail material, or craftsmanship related to a
uniqueness to the area, or the related distinctiveness of a craftsman, master builder or architect,
or a style or innovation, including but not limited to:;
1. Scale of buildings and structures typical of the area;
2. Architectural style of the buildings and structures;
EXHIBIT A - Revised Proposed Changes to the UDC
Page 13 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 13 of 50
Item # B
3. Architectural period of the buildings and structures;
4. Building materials typical of the area;
5. Colors and textures used in the buildings and structures typical of the area;
6. Typical relationships of buildings in the area to the street;
7. Setbacks and other physical patterns of buildings in the area;
8. Typical patterns of rooflines of buildings in the area; or
9. Typical patterns of porch and entrance treatments of buildings in the area; and
5.E. Archaeological value in the sense that the structure s, sites, or area has have produced or
can be expected to yield, based on physical evidence, information affecting knowledge of
history or prehistory; and.
6. Other unique historical value.
B. Required Findings
In recommending the application of an historic overlay designation to an area of the City, the
Historic and Architectural Review Commission shall recommend express findings to the City
Council regarding the specific structures, landscapes, or other physical aspects of the District on
which it bases the determination required by the criteria above.
C. Where the designation is made based on the general character of the District or landmark, these
findings may include, but shall not necessarily be limited to:
1. Scale of buildings and structures typical of the area;
2. Architectural style;
3. Architectural period;
4. Building materials typical of the area;
5. Colors used in buildings typical of the area;
6. Signage and street furniture typical of the area;
7. Landscapes typical of the area;
8. Typical relationships of buildings to the landscapes in the area;
9. Typical relationships of buildings in the area to the street;
10. Setbacks and other physical patterns of building in the area;
11. Typical patterns of rooflines of buildings in the area; and
12. Typical patterns of porch and entrance treatments of buildings in the area.
D. Where the designation is made based on the character of a limited number of specific buildings
in the area, the findings may include, but shall not necessarily be limited to:
1. Architectural style of the buildings;
2. Architectural period of the buildings;
3. Textures and colors of materials used in the buildings;
EXHIBIT A - Revised Proposed Changes to the UDC
Page 14 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 14 of 50
Item # B
4. Shapes of the buildings;
5. Rooflines of the buildings;
6. Porch and entrance treatments of the buildings;
7. Height and mass of the buildings; and
8. Relative proportions of the buildings (width to height, width to depth).
3.06.070 Approval Criteria (Historic Landmark Designation)
The City Council shall make the findings that one or more of the following criteria for designating a
building, structure or site within the City limits a local Historic Landmark is met:
A. Character, interest, or value of the building, structure or site because of its unique role in the
development, heritage or cultural characteristics of the city, county, state or nation;
B. Occurrence of a notable historical event at the building, structure or site;
C. Identification of the building, structure or site with a person or persons who contributed
notably to the culture and development of the city, county, state, nation, or society;
D. Distinctive elements of architectural design, detail material, or craftsmanship that make it an
established or familiar visual feature, or the related distinctiveness of a craftsman, master
builder or architect, or a style or innovation, including but not limited to:
1. Architectural style of the building or structure;
2. Architectural period of the building or structure;
3. Textures and colors of materials used in the building or structure;
4. Shape of the building or structure;
5. Roofline of the building or structure;
6. Porch and entrance treatments of the building or structure;
7. Height and mass of the building or structure; or
8. Relative proportions of the building or structure (width to height, width to depth); and
E. Archaeological value in the sense that the building, structure or site can be expected to yield,
based on physical evidence, information affecting knowledge of history or prehistory.
3.06.080 Interim Control during Historic Landmark or Historic Overlay District
Consideration
A. Upon deeming an application for a Historic Landmark or Historic Overlay District designation
complete, Nno Building Permit may be issued by the City for alteration, construction,
demolition or removal of any property building or structure located within an the area
proposed for such designation. to the Historic District
B. This Building Permit hold period shall commence onfrom the date the application for Historic
Landmark or Historic Overlay District designation is deemed complete until its final disposition
by the City Council. For City initiated requests, this Building Permit hold period shall
EXHIBIT A - Revised Proposed Changes to the UDC
Page 15 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 15 of 50
Item # B
commence on the date the Resolution to initiate the request is adopted until final disposition by
the City Council.
C. The Building Permit hold period shall not apply to, unless such alterations, removal or
demolition is authorized by formal action of the Building Standards Board as necessary for
preservation of the public health, welfare or safety as provided for Dangerous Buildings in
Chapter 15 of the City Code of Ordinances. In no event will the delay be for more than 120 days.
Section 3.12 Master Sign Plan
3.12.010 Applicability
A Master Sign Plan shall be required for all multiple-tenant buildings, Planned Unit Developments,
and all multi-building or multi-occupant commercial developments before any signs for such
development may be erected on the property. All owners, tenants, subtenants, and purchasers of
individual units within the development shall comply with the approved Master Sign Plan.
3.12.020 Review Process
A. Review of a Master Sign Plan shall follow the procedure set forth in Section 3.03.0403.03.050,
save and except a Master Sign Plan for property located in a Historic Overlay District.
B. Review of a Master Sign Plan for property in a Historic Overlay District shall follow the
procedure set forth in Section 3.13 of this Code.
3.12.030 Criteria for Approval
In addition to the general administrative review criteria in Section 3.03.040.D 3.03.050.D or 3.13 for
property in a Historic Overlay District, the Building Official or Historic and Architectural Review
Commission, as applicable, must determine the following in order to approve the Master Sign Plan:
A. The plan provides that signs of a similar type and function within the development will have a
consistent building material.;
B. The plan provides for signs that meet the size limitations, location requirements, and other
applicable requirements of this Unified Development Code.; and
C. Plans for property located in a Historic Overlay District shall be in keeping with the adopted
design guidelines Downtown and Old Town Design Guidelinesof the Historic Overlay District.
3.12.040 Responsibility for Final Action
A. The Building Official is responsible for final action on Master Sign Plans, save and except
Master Sign Plans for property located in a Historic Overlay District. A sign permit shall also be
required in accordance with Section 3.18.
B. The Historic and Architectural Review Commission is responsible for final action on Master
Sign Plans for property located in a Historic Overlay District.
C. A Sign Permit for all signs in the Master Sign Plan shall also be required in accordance with
Section 3.18.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 16 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 16 of 50
Item # B
3.12.050 Expiration
A Master Sign Plan shall expire 24 months after the date that the Master Sign Plan was approved
unless:
A. A Building Permit application has been approved or, if no Building Permit is required, a
Certificate of Occupancy, or equivalent, has been issued.
B. In case of projects where more than one building or phase is to be built, the applicant may
submit a series of Building Permit applications. The first application must be approved within
12 months from the date Site Plan approval is granted. Each subsequent application must be
submitted within 24 months from the date of issuance of a Certificate of Occupancy by the
Building Official for the previous phase of the development.
[Existing Section 3.13 removed and replaced by new Section 3.13 as
follows:]
Section 3.13 Certificate of Appropriateness
3.13.010 Applicability
A. Pursuant to the authority granted to the City by Texas Local Government Code Chapter 211 and
the City Charter, a Certificate of Appropriateness is required in accordance with Table 3.13.010
below. Activities that include more than one Project (Scope of Work) shall be subject to the
review process and criteria for approval for each specific Project as identified in Table 3.13.010.
Table: 3.13.010: Certificate of Appropriateness Required
Project (Scope of Work) Historic Significance Review
Authority
HARC = Historic and Architectural Review Commission * HPO = Historic Preservation Officer * NR = Not Required
New Construction (Infill Development)
New building construction All Historic Overlay Districts HARC
Additions
To create or add to an existing street facing facade
Historic Landmark
HARC Contributing Historic Structure
Non-Contributing Historic Structure HPO
Non-street facing façades
Historic Landmark HARC
Contributing Historic Structure HPO
Non-Contributing Historic Structure NR
New addition does not comply with the zoning
standards of the historic overlay district
Historic Landmark
HARC Contributing Historic Structure
Non-Contributing Historic Structure
EXHIBIT A - Revised Proposed Changes to the UDC
Page 17 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 17 of 50
Item # B
Project (Scope of Work) Historic Significance Review
Authority
HARC = Historic and Architectural Review Commission * HPO = Historic Preservation Officer * NR = Not Required
Additions (continued)
Awning or canopy
Historic Landmark HARC
Contributing Historic Structure* HPO
HARC
Non-Contributing Historic Structure* NR
HPO
Porch, patio or deck
Historic Landmark
HARC Contributing Historic Structure*
Non-Contributing Historic Structure* NR
HPO
Reconstruction, Alterations, Changes
Restoring original door or window openings historic
architectural features
Historic Landmark
HPO Contributing Historic Structure*
Non-Contributing Historic Structure NR
Replacing a historic architectural feature with a non-
historic architectural feature
Historic Landmark
HARC Contributing Historic Structure*
Non-Contributing Historic Structure NR
Replacing roof materials with different roof
materials
Historic Landmark HARC
Contributing Historic Structure HPO
Non-Contributing Historic Structure NR
Modifications to exterior steps, stairways and ramps
using in-kind material
Historic Landmark
HPO Contributing Historic Structure*
Non-Contributing Historic Structure NR
Modifications to exterior steps, stairways and ramps
Historic Landmark HARC
Contributing Historic Structure* HPO
HARC
Non-Contributing Historic Structure* HPO
EXHIBIT A - Revised Proposed Changes to the UDC
Page 18 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 18 of 50
Item # B
Project (Scope of Work) Historic Significance Review
Authority
HARC = Historic and Architectural Review Commission * HPO = Historic Preservation Officer * NR = Not Required
Reconstruction, Alterations, Changes (continued)
Paint removal from historic and significant
architectural features (back to original condition;
does not include repainting)
Historic Landmark
HPO Contributing Historic Structure*
Non-Contributing Historic Structure
NR
Changes to paint color on previously painted
surfaces (includes repainting or new paint on
previously painted surface)
Historic Landmark
HPO Contributing Historic Structure*
Non-Contributing Historic Structure*
New paint on unpainted historic and other
significant architectural features
Historic Landmark
HPO Contributing Historic Structure*
Non-Contributing Historic Structure NR
Changes in color to awning fabric
Historic Landmark
HPO Contributing Historic Structure*
Non-Contributing Historic Structure*
Exterior lighting that is attached to the building or
structure
Historic Landmark
HPO Contributing Historic Structure*
Non-Contributing Historic Structure*
Rooftop HVAC, mechanical or communication
equipment that result in no modifications to the
building façade
Historic Landmark*
HPO Contributing Historic Structure*
Non-Contributing Historic Structure*
Rooftop HVAC, mechanical or communication
equipment that result in modifications to the
building façade
Historic Landmark
HARC Contributing Historic Structure*
Non-Contributing Historic Structure* HPO
Removal, Demolition or Relocation
Awnings or canopies
Historic Landmark HARC
Contributing Historic Structure* HPO
HARC
Non-Contributing Historic Structure NR
Exterior non-historic architectural features
Historic Landmark
HPO Contributing Historic Structure*
Non-Contributing Historic Structure NR
EXHIBIT A - Revised Proposed Changes to the UDC
Page 19 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 19 of 50
Item # B
Project (Scope of Work) Historic Significance Review
Authority
HARC = Historic and Architectural Review Commission * HPO = Historic Preservation Officer * NR = Not Required
Removal, Demolition or Relocation (continued)
Exterior siding to unencapsulate historic siding
materials
Historic Landmark
HPO Contributing Historic Structure*
Non-Contributing Historic Structure NR
Removal, stripping, concealing, or destruction of
any historic and architectural features that is
integral to the historic character of the building or
structure, or historic overlay district
Historic Landmark
HARC Contributing Historic Structure*
Non-Contributing Historic Structure* HPO
Non-historic additions that are made of non-historic
materials
Historic Landmark
HPO Contributing Historic Structure
Non-Contributing Historic Structure NR
Attached carport, porch, patio or deck
Historic Landmark
HARC‡ Contributing Historic Structure*
Non-Contributing Historic Structure NR
Attached carport, porch, patio or deck made of non-
historic materials
Historic Landmark
HPO Contributing Historic Structure*
Non-Contributing Historic Structure NR
Reopen enclosed porch, patio or deck to original
condition
Historic Landmark
HPO Contributing Historic Structure*
Non-Contributing Historic Structure NR
Street facing façade
Historic Landmark
HARC‡ Contributing Historic Structure
Non-Contributing Historic Structure NR
30% 15% or more of the square footage of a
building
Historic Landmark
HARC Contributing Historic Structure
Non-Contributing Historic Structure NR
Less than 30% 15% of the square footage of a
building
Historic Landmark HARC
Contributing Historic Structure HPO
Non-Contributing Historic Structure NR
EXHIBIT A - Revised Proposed Changes to the UDC
Page 20 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 20 of 50
Item # B
Project (Scope of Work) Historic Significance Review
Authority
HARC = Historic and Architectural Review Commission * HPO = Historic Preservation Officer * NR = Not Required
Removal, Demolition or Relocation (continued)
Relocation of a building or structure on the same lot
Historic Landmark
HPO Contributing Historic Structure
Non-Contributing Historic Structure
Relocation of a building or structure to a historic
overlay district (includes relocation of buildings or
structures within the same historic overlay districts)
Historic Landmark
HARC Contributing Historic Structure
Non-Contributing Historic Structure
Relocation of a building or structure outside of the
historic overlay district
Historic Landmark
HARC Contributing Historic Structure
Non-Contributing Historic Structure NR
Signage
Master Sign Plan
All Historic Overlay Districts
HARC
New signage, to include new signage that is
consistent with an approved Master Sign Plan HPO
New signage that is inconsistent with an approved
Master Sign Plan or applicable guidelines HARC
Changes in content or configuration (re-facing) that
do not involve changes in sign location, dimensions,
lighting or total sign area
HPO
Amending an approved Master Sign Plan HARC
Fences
New fence, railing or wall that is consistent with the
overlay district’s characteristics and applicable
guidelines
All Historic Overlay Districts†
HPO
New fence, railing or wall that is inconsistent with
the overlay district’s characteristics and applicable
guidelines HARC
Removal of chain, link, plywood, or vinyl fence and
replacing with wood, wrought iron, or masonry HPO
Miscellaneous
HARC exceptions (building height and setback
variations pursuant to Section 4.08) All Historic Overlay District HARC
Renewal of an expired Certificate of Appropriateness All Historic Overlay Districts
HPO Historic Landmark
*Only applicable to a street facing façade
†Only applicable to fences along a street lot line or located in a street yard
‡CLG demo delay period and Demolition Subcommittee review not applicable
EXHIBIT A - Revised Proposed Changes to the UDC
Page 21 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 21 of 50
Item # B
B. Exemptions
A Certificate of Appropriateness shall not be required for the following:
1. Ordinary Maintenance and Repair, as this term is defined in Chapter 16 of this Code.
2. Interior construction or alterations provided the alterations do not alter the exterior wall of
the building.
3. New single-family and two-family residential development in the Old Town Overlay
District provided the building is in compliance with the zoning standards of the Historic
Overlay District.
4. New additions to existing single-family and two-family structures provided the addition
does not create or add to a street facing façade, and the addition in combination with the
existing building is in compliance with the zoning standards of the Historic Overlay District.
5. New, modifications or removal of to existing awnings (to include changes in color),
canopies, exterior paint color or exterior lighting fixtures that is are attached to a single-
family or two-family residential structure provided the alterations do not alter the exterior
wall of a building designated as a Historic Landmark.
6. Demolition of a building or structure that the Building Official has declared a dangerous
structure in accordance with Chapter 15.40 of the City Code, as amended, or determined
that demolition is necessary for the preservation of the public health, safety and welfare.
a. Should the Building Official declare a building a dangerous structure or determine that
demolition is necessary for the preservation of public health, safety and welfare, the
Building Official shall coordinate with the Historic Preservation Officer and property
owner to identify historic and significant architectural features that are unique to the
building or structure, era or district and that may be salvaged.
b. The Historic Preservation Officer shall create a record of the building or structure to be
demolished through archival-quality photo-documentation, drawings, and other
information similar to those required by the Historic American Buildings Survey. The
list of identified historic and significant architectural features to be salvaged shall also be
made part of this record.
7. Site alterations and other hardscape features provided that these do not alter a building or
structure designated as a Historic Landmark or that is a contributing historic structure to the
Historic Overlay District.
C. No Building Permit shall be issued by the Building Official for any building or structure
designated as a Historic Landmark or that is located in a Historic Overlay District until the
application for such permit has been reviewed and approved by the Historic and Architectural
Review Commission or the Historic Preservation Officer, as applicable, and the project, as
proposed, is in compliance with all other applicable regulations of this Code.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 22 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 22 of 50
Item # B
3.13.020 Certificate of Appropriateness – Administrative Approval
A. Review Process
1. Initiation
Initiation of a Certificate of Appropriateness to the Historic Preservation Officer may be
made upon application by the property owner of the affected property or their authorized
agent following the established application processes and requirements of this Chapter.
2. Application Completeness
a. The applicant shall submit all of the information and materials required in the UDC
Development Manual as specified on the applicable Certificate of Appropriateness
checklist.
b. The Historic Preservation Officer shall determine that a complete application has been
submitted with all material necessary to review the Certificate of Appropriateness’
conformance with applicable criteria for approval in accordance with this Code.
3. Staff Review
Once a Certificate of Appropriateness has been initiated and the application deemed complete,
the Historic Preservation Officer shall review the application for consistency with any
applicable criteria for approval.
4. Responsibility for Final Action
a. The Historic Preservation Officer is responsible for final action on a Certificate of
Appropriateness for certain projects as specified in Section 3.13.010 of this Code.
b. Should the Historic Preservation Officer be unable to approve the request, the Historic
Preservation Officer may forward the request to the Historic and Architectural Review
Commission for review and final action at the next available meeting following public
notification in accordance with Section 3.03 of this Code.
B. Criteria for Approval
The Historic Preservation Officer shall determine whether to grant a Certificate of
Appropriateness based on the following criteria:
1. The application is complete and the information contained within the application is correct
and sufficient enough to allow adequate review and final action;
2. Compliance with applicable design and development standards of this Code;
3. Compliance with the Secretary of the Interior’s Standards for the Treatment of Historic
Properties to the most extent practicable;
4. and Compliance with the adopted Downtown and Old Town Design Guidelines, as may be
amended from time to time, specific to the applicable Historic Overlay District; and
5. The overall character of the applicable Historic Overlay District and the building or structure is
preserved, and the design is consistent compatible with the Historic Overlay District.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 23 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 23 of 50
Item # B
3.13.030 Certificate of Appropriateness – HARC Approval
A. Review Process
1. Initiation
Initiation of a Certificate of Appropriateness to the Historic and Architectural Review Commission
may be made upon application by the property owner of the affected property or their
authorized agent following the established application processes and requirements of this
Chapter.
2. Application Completeness
a. The applicant shall submit all of the information and materials required in the UDC
Development Manual as specified on the applicable Certificate of Appropriateness
checklist.
b. The Historic Preservation Officer shall determine that a complete application has been
submitted with all material necessary to review the Certificate of Appropriateness’
conformance with applicable criteria for approval in accordance with this Code.
3. Staff Review
a. Once a Certificate of Appropriateness has been initiated and the application deemed
complete, the Historic Preservation Officer shall review the application for consistency
with any applicable criteria for approval.
b. The Historic Preservation Officer shall prepare a report to the Historic and Architectural
Review Commission.
c. The Historic Preservation Officer’s report shall include a recommendation for final
action.
4. Responsibility for Final Action
a. The Historic and Architectural Review Commission shall review the application, the
Historic Preservation Officer’s report, conduct a hearing in accordance with the Historic
and Architectural Review Commission’s established procedures and state law, and take
final action on the application within 35 days of the application hearing unless the
applicant agrees to extend the time.
b. An application before the Historic and Architectural Review Commission shall be
considered approved by a majority vote of all members of the Historic and Architectural
Review Commission.
B. Criteria for Approval
The Historic and Architectural Review Commission shall determine whether to grant a Certificate
of Appropriateness based on the following criteria:
1. The application is complete and the information contained within the application is correct
and sufficient enough to allow adequate review and final action;
2. Compliance with any design standards of this Code;
3. Compliance with the Secretary of the Interior’s Standards for the Treatment of Historic
Properties to the most extent practicable;
EXHIBIT A - Revised Proposed Changes to the UDC
Page 24 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 24 of 50
Item # B
4. and Compliance with the adopted Downtown and Old Town Design Guidelines, as may be
amended from time to time, specific to the applicable Historic Overlay District;
5. The general historic, cultural, and architectural integrity of the building, structure or site is
preserved;
6. New buildings or additions are designed to be compatible with surrounding properties in
the applicable Historic Overlay District;
7. The overall character of the applicable Historic Overlay District is protected; and
8. The Master Sign Plan is in keeping with the adopted Downtown and Old Town Design
Guidelines and character of the Historic Overlay District.
C. Additional Criteria for Approval for Building Height Exceptions
1. Applicants requesting exceptions to the building height standards set forth in Section
4.08.020.A must submit documentation to HARC that the following standards will be met if
the requested exception to the height standards is approved:
a. The proposed building or addition shall not obscure views to and from the Courthouse
or overwhelm or detract from views of the Town Square Historic District;
b. The proposed building or addition shall be compatible with the height, scale, massing,
and volume reflected in the Downtown Overlay District, and the historic character of
the District; and
c. The proposed building shall be an extraordinary contribution to the aesthetic and
economic goals of the Downtown Master Plan.
2. The documentation required by Section 3.13.030.C.1 must include, at a minimum, the
following information:
a. A visual analysis that identifies:
i. The extent to which the building would impact views to and from the Courthouse,
and to what extent the building will be visible from four directions; and
ii. How the building will relate to the context of the surrounding structures and the
character of the District; and
b. A summary of the conclusions of the visual analysis as to how the proposed building
will impact the District, specifically the immediate surroundings.
3. HARC may grant a request for a variation in height from the standards set forth in Section
4.08.020.A only if it determines that the following goals or purposes will still be achieved:
a. Views to and from the Courthouse and to and from the Town Square Historic District
will be protected; and
b. The character of the Downtown Overlay District and the Town Square Historic District
will be defined, reinforced, and preserved; and
c. The relationship of the proposed project to the existing structures in the immediate
vicinity remains consistent; and
d. The proposed project allows for the best utilization of redevelopment in the Downtown
Overlay District and the Town Square Historic District; and
EXHIBIT A - Revised Proposed Changes to the UDC
Page 25 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 25 of 50
Item # B
e. The proposed project protects the historic buildings in the Downtown Overlay District.
D. Additional Criteria for Approval of a Setback Exception
1. The Historic and Architectural Review Commission may grant a Certificate of
Appropriateness, per Section 4.08.080.D of this Code, to modify the setback standards of the
underlying base zoning district for residential properties located within the Old Town
Overlay District.
2. HARC may take in consideration the following in determining whether to approve a
Certificate of Appropriateness for a setback exception:
a. Whether the proposed setback encroachment is solely a matter of convenience;
b. Whether there is adequate room on the site to allow the proposed addition or new
structure without encroaching into the setback;
c. Whether the proposed setback is compatible and in context within the block in which
the subject property is located;
d. Whether the proposed addition or new structure will be set closer to the street than
other units within the block;
e. Whether the proposed structure is replacing a structure removed within the past year;
f. Whether the proposed structure will replace a structure that previously existed with
relatively the same footprint and encroachment as proposed;
g. If the proposed encroachment is for a structure that is replacing another structure,
whether the proposed structure is significantly larger than the original;
h. If the proposed encroachment is for an addition, the scale of the addition compared to
the original house;
j. The size of the proposed structure compared to similar structures within the same block;
k. Whether the proposed addition or new structure will negatively impact adjoining
properties, including limiting their ability to maintain existing buildings;
l. Whether there is adequate space for maintenance of the proposed addition or new
structure and/or any adjacent structures; and/or
m. Whether the encroachment would enable existing large trees or significant features of
the lot to be preserved.
E. Additional requirements for relocation, removal or demolition of a Historic
Landmark or contributing historic structure
In addition to the Staff Review process established in Section 3.13.030.A, applications for a
Certificate of Appropriateness for the relocation, removal or demolition of a building or
structure designated as a Historic Landmark or contributing historic structure to the Historic
Overlay District shall be subject to the following additional review:
1. Demolition Delay Period Certified Local Government (CLG) Program
a. Upon deeming the application complete, requests for a Certificate of Appropriateness
for demolition of a Historic Landmark or contributing historic structure shall be subject
to a 60-day demolition delay period. The Historic and Architectural Review Commission
EXHIBIT A - Revised Proposed Changes to the UDC
Page 26 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 26 of 50
Item # B
shall not take action on a request for demolition until the 60-day demolition delay period
is complete.
b. During this 60-day delay period, the applicant shall coordinate with the Historic
Preservation Officer to reach a satisfactory resolution that preserves the building or
structure, or that preserves historic and significant architectural features that are unique
to the building or structure, era or district.
c. The Historic Preservation Officer shall coordinate with local, county and other historic
organizations to explore possibilities for preserving, to include the possible relocation of
the structure.
d. The Historic Preservation Officer shall present the findings and resolution, if applicable,
to the Historic and Architectural Review Commission with the request.
2. Demolition Subcommittee Review
a. No later than the 30th day from deeming the application complete, the Historic and
Architectural Review Commission’s Demolition Subcommittee shall complete a walk-
through of the building or structure proposed to be demolished or relocated with the
Historic Preservation Officer and the applicant.
b. The Demolition Subcommittee shall review the application and analyze the building or
structure to determine possibility of preservation and restoration, and appropriateness
for demolition or relocation. In the event of demolition, the Demolition Subcommittee
shall also create a list of historic salvageable materials identified during the walk-
through.
c. The Demolition Subcommittee’s report shall include a recommendation for final action.
3. Responsibility of Final Action
a. In addition to the application and Historic Preservation Officer’s report, the Historic and
Architectural Review Commission shall review the recommendation by the Demolition
Subcommittee, conduct a Hearing in accordance with the HARC’s established
procedures and state law, and take final action on the application within 35 days of the
application Hearing unless the applicant agrees to extend the time.
b. As conditions of approval, the Historic and Architectural Review Commission may
require historic materials to be salvaged, archival-quality photo-documentation, and/or
architectural drawings of the building or structure proposed to be demolished or
relocated similar to those required by the Historic American Buildings Survey to be
submitted to the Historic Preservation Officer.
F. Criteria for Approval for relocation, removal or demolition of a Historic Landmark or
contributing historic structure
1. The Historic and Architectural Review Commission shall use circumstances or items that are
unique to the building or structure proposed to be relocated, removed or demolished when
reviewing the application.
2. The Historic and Architectural Review Commission shall make the following findings when
considering a request for demolition or relocation of a structure:
a. Loss of Significance
EXHIBIT A - Revised Proposed Changes to the UDC
Page 27 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 27 of 50
Item # B
i. The applicant has provided information that the building or structure is no longer
historically, culturally or architecturally significant, or is no longer contributing to
the Historic Overlay District; and
ii. The applicant has established that the building or structure has undergone
significant and irreversible changes, which have caused the building or structure to
lose the historic, cultural or architectural significance, qualities or features which
qualified the building or structure for such designation; and
iii. The applicant has demonstrated that any changes to the building or structure were
not caused either directly or indirectly by the owner, and were not due to
intentional or negligent destruction, or lack of maintenance rising to the level of a
demolition by neglect; and
iv. Demolition or relocation of the building or structure will not cause significant
adverse effect on the Historic Overlay District or the City’s Historic Resources; or
b. Unreasonable Economic Hardship
i. The applicant has demonstrated that the property owner cannot take reasonable,
practical or viable measures to adaptively use, rehabilitate or restore the building or
structure, or make reasonable beneficial use of, or realize a reasonable rate of return
on a building or structure unless the building or structure may be demolished or
relocated; and
ii. The applicant must prove that the structure cannot be reasonably adapted for any
other feasible use, which would result in a reasonable rate of return; or
c. There is a compelling public interest that justifies relocation, removal or demolition of
the structure.
3. Relocation of a structure to a Historic Overlay District
In the event the building or structure is proposed to be relocated to a property in a Historic
Overlay District, in addition to the above, the applicant must demonstrate the following
with the application:
a. The architectural compatibility of the relocated building or structure with adjacent
buildings according to the applicable Downtown and Old Town Design Guidelines and
UDC standards for new construction; and
b. The proposed siting, setback and other applicable site-specific treatments according to
pertinent Downtown and Old Town Design Guidelines and UDC standards of the
applicable Historic Overlay District; and
c. Relocation will not damage existing contributing historic buildings or structures, or the
character of the Historic Overlay District.
3.13.040 Relocation, removal or demolition prior to approval of a Certificate of
Appropriateness
A. Demolition, including demolition by neglect, of a building or structure prior to approval of a
Certificate of Appropriateness by the Historic and Architectural Review Commission, when
required, shall be subject to an automatic hold on all permits. No permit may be granted until
this period is complete and the Historic and Architectural Review Commission has granted a
EXHIBIT A - Revised Proposed Changes to the UDC
Page 28 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 28 of 50
Item # B
Certificate of Appropriateness for the demolition of the remaining building or structure, if
applicable.
B. The permit delay period shall be determined by the Historic and Architectural Review
Commission, but in no case shall it exceed 365 days.
C. The Certificate of Appropriateness for the demolition of the remaining building or structure, if
applicable, shall be reviewed and final action taken by the Historic and Architectural Review
Commission concurrently with the determination of the longevity of the permit hold period.
D. During this delay period, the applicant shall provide the following information to the Historic
Preservation Officer:
1. Documentation regarding the original and existing condition of the building or structure, to
include structural integrity and the extent of work necessary to stabilize the building or
structure.
2. Site Development Plan (or Plot Plan) identifying proposed development on site following
demolition of the building or structure.
3. List of any salvageable materials, and a plan offering donation or sale of the remaining
building or structure and any salvageable materials identified.
E. In the event of demolition by neglect, the applicant shall complete any work required to
stabilize and arrest further deterioration of the building or structure.
3.13.050 Certificate and Compliance Inspections
A. It shall be the responsibility of the Historic Preservation Officer to issue the actual Certificate of
Appropriateness following approval by the Historic Preservation Officer or the HARC, with any
designated conditions, and to maintain a copy of the Certificate of Appropriateness, together with
the proposed plans. The Certificate shall be forwarded to the Building Official. These shall be
public documents for all purposes.
B. Work performed pursuant to the issuance of a Certificate of Appropriateness shall conform to the
requirements of the Certificate. In the event that work is not in compliance, the Building Official
shall issue a stop work order and/or citation as prescribed by ordinance.
3.13.060 Limits on Resubmission
No application for the same project shall be considered within 180 days of the rejection or disapproval
by the Historic and Architectural Review Commission or Historic Preservation Officer, as applicable, of an
application. The applicant may submit a design for an entirely new project or a revised design that
substantially responds to the reasons for denial as set forth by the Historic and Architectural Review
Commission or Historic Preservation Officer, as applicable, at any time.
3.13.070 Expiration
A. A Certificate of Appropriateness, except as noted below, expires if the work authorized by the
Certificate of Appropriateness is not commenced within 24 months from the date of the final
action to approve the request. In the case of a phased project, after the initial phase is complete
or a Certificate of Occupancy has been issued, each subsequent phase shall commence within 24
months of the completion or Certificate of Occupancy of the prior phase. The Historic
Preservation Officer may extend the time commencement of work upon written request by the
applicant.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 29 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 29 of 50
Item # B
B. A Certificate of Appropriateness for relocation, removal or demolition expires if a Permit for
relocation or demolition has not been issued within 180 days or, if a permit is not required, the
work authorized by the Certificate of Appropriateness is not commenced within 180 days from
the date of the final decision to approve the request. The Historic Preservation Officer may
extend the time for commencement of work upon written request of the applicant.
3.13.080 Appeals
A person aggrieved by a final action of the Historic and Architectural Review Commission on a
Certificate of Appropriateness may appeal to the City Council, pursuant to the procedures set forth
below. Such appeal shall be submitted to the Historic Preservation Officer within 30 days of the final
action.
Appeals from an administratively issued Certificate of Appropriateness will be processed through the
Historic and Architectural Review Commission, subject to the procedures established for new
applications. Such appeal shall be submitted to the Historic Preservation Officer within 30 days of the
administrative action.
A. Appeal Hearing
The Hearing shall be set for the next available City Council or HARC meeting, subject to the
provision of public notification. Notification shall be provided in the same manner as the initial
Certificate of Appropriateness.
B. Burden of Proof in Appeals
When an appeal is considered by the appellate body, the final action by the original reviewing
authority is presumed to be valid. The person filing the appeal shall present sufficient evidence
and have the burden to justify a reversal of the action being appealed.
C. Findings and Conclusions
All findings and conclusion necessary to the appeal decision shall be based upon reliable
evidence. Competent evidence (evidence admissible in a Court of Law) will be preferred
whenever reasonably available, but in no case may findings be based solely upon incompetent
evidence unless competent evidence is not reasonably available, the evidence in question
appears to be particularly reliable, and the matter at issue is not seriously disputed. In
exercising its authority, the appellate body may reverse or affirm, in whole or in part or modify
the original order, requirement, decision, or determination from which an appeal is taken and
make the correct order, requirement, decision, or determination, and for that purpose the
appellate body has the same authority as the original reviewing authority.
D. Decision on Appeal
The appellate body shall review the application, the staff report and meeting minutes, conduct a
Hearing in accordance with established procedures and state law, and take final action on the
appeal. It shall require a concurring vote of a majority of the appellate body’s members to
overturn a decision on a Certificate of Appropriateness.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 30 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 30 of 50
Item # B
Section 3.15 Variance and Special Exception
3.15.040 Criteria for Special Exception Review
If authorized by this Code, the Zoning Board of Adjustment may grant a Special Exception from the
requirements of the certain provisions of this Unified Development Code, if the Special Exception is
not contrary to the public interest and the spirit of this Code is preserved and substantial justice done.
No Special Exception shall be granted unless the ZBA finds the specific criteria identified in this Code
are met. The only Special Exceptions that may be granted by the Board are for the following:
• Residential Setback Modifications pursuant to Section 4.09.040 and 6.06.010.D
• Time Extension for an Abandoned Nonconforming Use, pursuant to Section 14.01.060.B.7
• Expansion of Nonconforming Use, pursuant to Section 14.02.050
• Right to Continue Nonconforming Use after destruction or damage, pursuant to Section
14.02.060.A
• Abandonment of a Nonconforming Structure Determination, pursuant to Section 14.04.050
• Expansion of a Nonconforming Structure, pursuant to Sections 14.04.080.B & C
• Abandonment of a Nonconforming Site, pursuant to Section 14.05.050
• A setback exception, pursuant to Section 14.05.050.D
• Expansion of a Nonconforming Site, pursuant to Sections 14.05.080.B & C
EXHIBIT A - Revised Proposed Changes to the UDC
Page 31 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 31 of 50
Item # B
Chapter 4 Zoning Districts
Section 4.04 Zoning District Purpose Statements
4.04.040 Mixed-Use Zoning Districts
A. Mixed Use Downtown District (MU-DT)
The Mixed Use Downtown District (MU-DT) is intended to provide a location for a mix of land
uses including general commercial and retail activities, office as well as Single-family and Multi-
family in the downtown area. Developments in the MU-DT District are typically smaller in size
and scope although there may be occasionally heavy traffic. The Mixed Use Downtown District is
only appropriate in the traditional downtown area of Georgetown. Properties in MU-DT shall
meet the design requirements of the Downtown Overlay District, and Downtown and Old Town
Design Guidelines.
* For Uses allowed in the MU-DT District, see Chapter 5
* For Lot and Dimensional Standards, see Section 7.03
* For Building and Site Design Standards, see Sections 7.04 and 7.05
* For Downtown Overlay District Design Standards, see Section 4.08
* See also the Downtown Master Plan in the Comprehensive Plan
* See also the Downtown and Old Town Design Guidelines, referenced in Section 1.14
4.04.050 Overlay Zoning Districts
A. Special Area Plan Overlay District (SP)
B. Historic Overlay Districts
The City of Georgetown recognizes that as a matter of public policy the protection, enhancement,
and perpetuation of landmarks and districts of historical and cultural importance and
significance is necessary to promote the economic, cultural, educational, and general welfare of
the public. Historic Overlay Districts are created to:
• Protect and enhance the landmarks and districts which represent distinctive elements of
Georgetown’s historic, architectural, and cultural heritage;
• Foster civic pride in the accomplishments of the past;
• Protect and enhance Georgetown’s attractiveness to visitors and the support and stimulus
to the economy thereby provided;
• Insure the harmonious, orderly, and efficient growth and development of the city that is
sensitive to its historic resources;
• Promote economic prosperity and welfare of the community by encouraging the most
appropriate use of historic properties within the city; and
• Encourage stabilization, restoration, and improvements of such properties and their
values by offering incentives for rehabilitation and preservation.
1. Downtown Overlay District (D)
The Downtown Overlay District is intended to protect the aesthetic and visual character of
the Town Square and downtown Georgetown through the establishment of two distinct
EXHIBIT A - Revised Proposed Changes to the UDC
Page 32 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 32 of 50
Item # B
zones, designated as Area 1 (Town Square Historic District) and Area 2 (remainder of the
Downtown Overlay District). All development within the Downtown Overlay District,
except ordinary maintenance and repair, shall be reviewed in accordance with the adopted
Design Guidelines by the Historic and Architectural Review Commission, which shall
review the location, character, and appearance of proposed development, renovation, or
redevelopment activity.
* For Specific Standards of the Downtown Overlay District, see Section 4.08
C2. Old Town Overlay District (OT)
The Old Town Overlay District is intended to preserve and protect historic structures,
maintain a residential appearance along South Austin and University Avenues, and
maintain the integrity of the historic character in the area commonly referred to as Old
Town.
* For Specific Standards of the Old Town Overlay District, see Section 4.0908
D3. Designated Historic Overlay District (H)
The Designated Historic Overlay District (H) is intended to preserve areas, structures, and
landmarks of historical or cultural significance. Each overlay designated district has may
have specific standards unique to the district, although developments in an Historic Overlay
District require a Certificate of Design Compliance from the Historic and Architectural
Review Commission.
1a. Designated Historic District: Town Square Designated Historic District (H-TS)
* For Specific Standards of the Town Square Designated Historic Overlay District, see
Section 4.1008
E4. Historic Landmark Designation (HL)
The purpose of the Historic Landmark Designation is to protect, preserve and enhance
buildings or structures of historical, architectural or cultural importance or value to the City
of Georgetown.
* For Specific Standards of the Historic Overlay Districts, see Section 4.08
C. Courthouse View Protection Overlay District (CVP)
FD. Gateway Overlay District (G)
[Existing Sections 4.08, 4.09, and 4.10 removed and replaced by new
Section 4.08 as follows:]
Section 4.08 Historic Overlay Districts
4.08.010 Designation of a Historic Overlay District
A. A Historic Overlay District may be established over any base zoning district within the city limits
and may be established over more than one base zoning district.
B. Creation or expansion of a Historic Overlay District requires approval by the City Council,
following the procedures for a Zoning Map Amendment in Section 3.06.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 33 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 33 of 50
Item # B
C. Consideration of Standards for a Designated Historic District
The following shall be considered when developing standards for a Designated Historic District:
1. The findings adopted by the City Council for a specific Designated Historic District shall
define the scope of the City’s interest in protecting the historic resource and shall provide the
guidelines to be used, along with the applicable regulations, in considering whether to grant
or deny a Certificate of Appropriateness.
2. HARC may develop and the City Council may approve supplemental guidelines as it may
deem necessary to implement the regulations of a particular Designated Historic District or
the findings applicable to the designation of a particular Designated Historic District. Such
guidelines may include, but are not limited to, the following.
a. Charts or samples of acceptable materials for siding, foundations, roofs, or other parts of
buildings;
b. Illustrations of appropriate architectural details;
c. Numerical specifications of appropriate rhythms or proportions;
d. Specifications of appropriate relationships to streets, sidewalks, other structures, and
buildings;
e. Illustrations of appropriate porch treatments or entrances; or
f. Illustrations of appropriate signage or street furniture.
4.08.020 Historic Overlay Districts Established
The Historic Overlay Districts are established as follows. Each Historic Overlay District includes all the
land within the boundary of the District shown on the Official Zoning Map.
A. Downtown Overlay District
The Downtown Overlay District was established by the City Council as part of adoption of
Ordinance No. 2001-48 on August 28, 2001 and expanded with the adoption of Ordinance No.
2014-86, adopted on October 28, 2014. The district is divided into two distinct zones, designated
as Area 1 and Area 2. The Downtown Overlay District is generally bounded by the river to the
north, the lots fronting the south side of University Avenue to the south, Martin Luther King, Jr.,
Street to the west, and Myrtle Street to the east. The Downtown Overlay District abuts, but does
not include, the Old Town Overlay District. The precise boundaries are depicted on the map
incorporated below.
[Insert updated map]
This map is available for viewing at the Planning Department office or as a downloadable map at
http://maps.georgetown.org.
B. Old Town Overlay District
The Old Town Overlay District was established by the City Council as part of adoption of
Ordinance No. 2004-22 on April 13, 2004. The Old Town Overlay District is generally bounded on
the north by 2nd Street; on the east by Holly Street, the railroad tracks, University Avenue, and
Hutto Road; on the south by 17th, 18th, and 19th Streets; and on the west by the properties on the
western side of Austin Avenue and the boundaries of the Downtown Overlay District. The Old
EXHIBIT A - Revised Proposed Changes to the UDC
Page 34 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 34 of 50
Item # B
Town Overlay District abuts, but does not include the Downtown Overlay District. The precise
boundaries are depicted on the map incorporated below.
[Insert updated map]
This map is available for viewing at the Planning Department office or as a downloadable map at
http://maps.georgetown.org.
C. Designated Historic Districts
Designation of a Historic District shall be established and governed in accordance with this Code.
This subsection contains all designated Historic Districts under this Code. Designated Historic
Districts are as follows:
1. Town Square Historic District
The City Council designated the Town Square Historic District by the adoption of Ordinance
No. 2001-48, the confines of which are defined as follows: All lots in Blocks 37, 38, 39, 40, 41,
50, 51, and 52 of the City of Georgetown, Texas, according to the map or plat thereof of record
and which lots are all of those properties on the nine blocks surrounding and including the
property that may commonly be referred to as the Public Square or Court House Square of
the City of Georgetown, Williamson County, Texas. The precise boundaries are depicted on
the map incorporated below.
[Insert map]
This map is available for viewing at the Planning Department office or as a downloadable map at
http://maps.georgetown.org.
D. Historic Landmark Designation
Designation of a Historic Landmark shall be established and governed in accordance with this
Code. Buildings or structures to be protected, preserved, restored and enhanced as a historic
resource and in the interest of the culture, prosperity, education, and welfare of the City of
Georgetown may be designated as a Historic Landmark by ordinance of the City Council. Upon
designation of a building or structure as a Historic Landmark, the City Council shall cause this
designation to be recorded in the official public record of real property of Williamson County and
the City of Georgetown official’s zoning map. All zoning maps shall reflect historic landmarks by
inclusion of the words “Historic Landmark” (HL) as a prefix to its use designation in accordance
with this Code.
4.08.030 Certificate of Appropriateness Required
All new buildings and changes to existing buildings located in a Historic Overlay District or
designated as a Historic Landmark are subject to the Certificate of Appropriateness provisions of
Section 3.13 of this Code. Any activity requiring review of a Certificate of Appropriateness per Section
3.13 of this Code will be subject to the Design Guidelines adopted by the City of Georgetown.
4.08.040 Applicability of Historic Overlay District Standards
A. Each designated Historic Overlay District may have unique standards that are described in the
adopting ordinance for that District.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 35 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 35 of 50
Item # B
B. The development and design standards contained within this Section are intended to supplement
any development and design standards of an underlying base zoning district. The standards of
the underlying base zoning district, as well as those of any other applicable overlay district, shall
remain in effect unless superseded by specific standards of the applicable Historic Overlay
District.
C. In the event of a conflict between the development regulations of the underlying zoning district
and the provisions of this Section, the provisions of this Section shall apply.
D. Any regulations for a specific Historic Overlay District shall apply to all properties or structures
wholly contained within that District and to those portions of any property or District located
within the District.
E. All uses permitted or conditionally permitted in the underlying zoning districts shall continue to
be permitted or conditionally permitted, respectively, unless otherwise specified in the specific
standard for the overlay district. HARC shall not have the authority to approve the specific use
of a site.
4.08.050 General Guidelines Applicable to All Historic Overlay Districts
A. The historic character of a building or structure should be retained and preserved. The removal
of historic materials or alteration of features and spaces that characterize a building or structure
should be avoided.
B. Each building or structure should be recognized as a physical record of its time, place, and use.
Changes that create a false sense of historical development, such as adding conjectural features or
architectural elements from other structures, should not be undertaken.
C. Most buildings or structures change over time; those changes that have acquired historic
significance in their own right should be retained and preserved.
D. Distinctive features, finishes, and construction techniques or examples of craftsmanship that
characterize a building or structure should be preserved.
F. Deteriorated historic features should be repaired rather than replaced. Where the severity of
deterioration requires replacement of a distinctive feature, the new feature should match the old
in design, color, texture, and other visual qualities and, where possible, materials. Replacement of
missing features shall be substantiated by documentary, physical, or pictorial evidence.
E. Chemical or physical treatments, such as sandblasting, that cause damage to historic materials
should not be used. The surface cleaning of structures, if appropriate, should be undertaken
using the gentlest means possible.
F. Significant archeological resources affected by a project should be protected and preserved. If
such resources must be disturbed, mitigation measures should be undertaken.
G. New additions, exterior alterations, or related new construction should not destroy historic
materials that characterize the building or structure. The new work should be differentiated from
the old and shall be compatible with the massing, size, scale, and architectural features to protect
the historic integrity of the building or structure and its environment.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 36 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 36 of 50
Item # B
H. New additions and adjacent or related new construction should be undertaken in such a manner
that if removed in the future, the essential form and integrity of the historic property and its
environment would be unimpaired.
4.08.060 Demolition by Neglect
A. An owner of a building or structure designated as a Historic Landmark or located in a Historic
Overlay District, or person with interest in the real property, shall not allow such structure to fall
into a serious state of disrepair so as to result in deterioration which would, in the judgment of
the Historic Preservation Officer and the Building Official, produce a detrimental effect upon the
life and character of the structure itself.
B. The Building Official and Historic Preservation Officer of the City of Georgetown shall determine
the “serious state of disrepair” in accordance with the most current form of the International
Property Maintenance Code. Examples of such deterioration include, but are not limited to, the
following:
1. Deterioration of walls or other vertical supports;
2. Deterioration of roofs or other horizontal members;
3. Deterioration of exterior chimneys;
4. Deterioration or crumbling of exterior stucco or mortar;
5. Ineffective waterproofing of exterior walls, roof or foundations, including broken windows or
doors;
6. Deterioration of exterior walls, doors, windows, or other means of interior access, so as to
create a danger of trespassing;
7. Deterioration of plumbing and electrical systems affecting the exterior of the structure; or
8. A hazardous condition resulting from the deterioration of any exterior feature, which might
indicate that demolition is necessary for the public safety.
C. A property owner, or person with interest in the real property, who is in violation of this Section
shall be subject to enforcement measures under Section 15.02.030 of this Code.
D. Should compliance with this Section require more than ordinary maintenance and repair, the
provisions of Section 3.13, Certificate of Appropriateness, shall be applicable.
4.08.070 Standards Specific to the Downtown Overlay District
This Section contains specific development and design standards applicable to properties located in the
Downtown Overlay District of the City of Georgetown.
A. Building Height
1. Building height in the Downtown Overlay District shall not exceed 40 feet, unless a
Certificate of Appropriateness is approved by HARC in accordance with the procedures set
forth in Section 3.13 of this Code.
2. Buildings located along the portion of Austin Avenue that lies within the boundaries of the
Downtown Overlay District shall be at least two usable stories in height with an overall
building height of not less than 20 feet, subject to compliance with the Courthouse View
EXHIBIT A - Revised Proposed Changes to the UDC
Page 37 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 37 of 50
Item # B
Protection Overlay District of Section 4.10. However, HARC may approve a Certificate of
Appropriateness in accordance with the procedures set forth in Section 3.13 of this Code.
B. Setbacks
Building setbacks adjacent to public rights-of-way in the Downtown Overlay District shall
generally be assumed to be zero (o) feet or “built to” the right-of-way line. Such setbacks shall be
reviewed on a case-by-case basis in accordance with the adopted Design Guidelines.
C. Parking
There shall be no off-street parking requirement in Area 1 of the Downtown Overlay District,
except as required by Section 5.04.020.M.2 of this Code. In Area 2 of the Downtown Overlay
District, the parking standards of Table 9.02.030.A shall apply. Alternative parking plans, as
described in Section 9.02.060 of this Code, may be considered.
D. Signs
The sign standards shall be those contained within the Downtown and Old Town Design
Guidelines. In the event that no standards exist, the standards in this Code shall apply, and may
be modified in order to more accurately reflect the express language or the intent of the Design
Guidelines in regard to signs.
4.08.080 Standards Specific to the Old Town Overlay District
This Section contains specific development and design standards applicable to properties located in the
Old Town Overlay District of the City of Georgetown.
A. Parking
The parking standards of Table 9.02.030.A shall apply. Alternative parking plans, as described in
Section 9.02.060 of this Code, may be considered.
B. Signs
The sign standards contained within the Downtown and Old Town Design Guidelines shall
apply. In the event that no standards exist, the standards of this Code shall apply and may be
modified in order to more accurately reflect the express language or the intent of the Design
Guidelines with regard to signs.
C. Building Height
1. Buildings within the Old Town Overlay District shall not exceed 30 feet in height. However,
a Certificate of Appropriateness may be approved in accordance with Section 3.13 of this
Code to allow utilization of the height limitation of the underlying zoning district.
2. Maximum building height at the prescribed setback of the underlying base zoning district
shall not exceed 15 feet. For each additional 3 feet of setback from the property line, the
building may increase in height by 5 feet. However, a Certificate of Appropriateness may be
approved in accordance with Section 3.13 of this Code to allow building heights in excess of
this requirement.
D. Setbacks
Setbacks shall be that of the underlying base zoning district. However, for residential structures
in the Old Town Overlay District, a Certificate of Appropriateness may be approved in
EXHIBIT A - Revised Proposed Changes to the UDC
Page 38 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 38 of 50
Item # B
accordance with Section 3.13 of this Code to allow a residential structure to encroach into a
required setback.
E. Floor-to-area Ratio
The floor-to-area-ratio (FAR) within the Old Town Overlay District shall not exceed 0.45, unless a
Certificate of Appropriateness is approved in accordance with Section 3.13 of this Code.
4.08.090 Standards Specific to Designated Historic Districts
A. Town Square Designated Historic District
The Town Square Historic District shall follow the standards set forth for the Downtown Overlay
District.
4.08.100 Standards Specific to Historic Landmark Designation
A. Design, alterations, additions and maintenance of a building or structure designated as a Historic
Landmark shall be in keeping with applicable guidelines of the Downtown and Old Town
Design Guidelines as adopted by the City Council.
B. Buildings, structures or sites designated as a Historic Landmark shall follow the standards set
forth of the applicable underlying and overlay zoning districts.
Section 4.1109 Mixed Use District
Section 4.1210 Courthouse View Protection Overlay District
Section 4.1311 Gateway Overlay District
EXHIBIT A - Revised Proposed Changes to the UDC
Page 39 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 39 of 50
Item # B
Chapter 6 Residential & Agriculture Zoning Districts: Lot,
Dimensional & Design Standards
Section 6.05 Dimensional Interpretations and Exceptions
6.05.020 Setbacks
B. Setback Reductions and Exceptions
1. On lots with approved rear access, the minimum front setback may be reduced to 15 feet.
2. On lots with an approved private rear access easement, rear setbacks shall be measured from
the nearest boundary of the easement. For all other lots, rear setbacks shall be measured
from the rear property line.
3. A minimum side setback of 10 feet shall be provided along all side lot lines that parallel a
public street, except as follows:
a. The side setback shall be 25 feet when adjacent to a roadway classified in this Code as a
freeway or the frontage road of a freeway.
b. The side setback shall be 20 feet for a garage or carport taking access from a side street.
(See Section 6.06.010)
4. Where the front, side and rear setbacks reduce the buildable width of an existing corner lot
to less than 40 feet, the Director is authorized to reduce the required front setback on the
longer street side as much as necessary to increase the buildable width to 40 feet. In the
event that the street sides of the lot are of equal length, the reduction shall be made on the
side which lies on the shorter side of the block.
5. When an existing setback is reduced because of a conveyance to a federal, state or local
government for a public purpose and the remaining setback is at least 50% of the required
minimum setback for the District in which it is located, then that remaining setback will be
deemed to satisfy the minimum setback requirements of this Code.
6. Properties in the Old Town Overlay District may request a Certificate of Appropriateness for
setback exception in accordance with Section 3.13 of this Code.Where an existing block was
acknowledged by the City or created by a plat recorded prior to May 10, 1977, an applicant
may request a setback modification pursuant to Section 4.09.040.
Section 6.06 Accessory Structures and Amenity Areas
6.06.010 Accessory Structures, Garages and Carports
The requirements of this Section apply to the AG, Agriculture District and all Residential Districts,
except as specified.
A. Accessory structures and buildings shall meet the dimensional standards of the base zoning
district, except as specified in this Section. However, properties in the Old Town Overlay District
may request a Certificate of Appropriateness for setback exception in accordance with Section
3.13 of this Code.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 40 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 40 of 50
Item # B
B. The accessory structure shall only be located on a lot with a principal structure, unless two
adjacent lots have common ownership, in which case the structures may be located on different
lots. In such instance, the accessory structure shall be located in the rear yard as determined by
the lot with the principal structure on it.
C. The square footage of an accessory structure shall not exceed 25% of the square footage of the
principal structure. For the purposes of this calculation, the square footage of a garage shall not
be considered part of the principal structure.
D. Accessory structures measuring 8 feet or less in height are allowed in the setbacks in the rear
yard up to 3 feet from the property line, but may not extend into any P.U.E. Properties in the Old
Town Overlay District must follow the procedures outlined in Section 4.09.040, Special Exception
for Setback Modification and the approval process pursuant to Section 3.15.
E. Garages and carports, whether attached or detached from the principal structure, shall be set
back a minimum of 20 feet from the public street from which the associated driveway takes
access or a minimum of 10 feet when taking access from a public alley.
F. No more than 30% of the rear yard may be covered with accessory buildings or structures. All
impervious cover requirements in Section 11.02 shall be met.
G. Accessory dwelling units located in accessory structures in the AG, RE, RL, and RS Districts are
allowed subject to the limitations provided for in Section 5.02.020.B or within a Housing
Diversity Development without limitations (as detailed in Section 6.07.020).
EXHIBIT A - Revised Proposed Changes to the UDC
Page 41 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 41 of 50
Item # B
Chapter 8 Tree Preservation, Landscaping and Fencing
Section 8.02 Tree Preservation and Protection
8.02.050 Tree Preservation Incentives and Priorities
B. Tree Preservation Priorities
1. Heritage Trees
The City values its Heritage Trees and, therefore, Heritage Tree protection may be
considered for priority over conflicting UDC development requirements, including, but not
limited to, setbacks, lot design standards, building heights, sidewalks, lighting, signage,
parking design and numbers, drainage criteria, connectivity, driveway separation and utility
extension and location. If there is a conflict between Heritage Tree protection and other
provisions of this Code, the applicant may request an alternative standard or design,
provided that public health and safety shall be maintained with all proposed designs. After
consultation with the Urban Forester, an alternative standard or design that gives priority to
Heritage Tree protection may be approved by the Director for administrative applications or
the Planning and Zoning Commission and the Historic and Architectural Review
Commission for applications under their approval authority. Appeal of a Heritage Tree
Protection Priority decision by any of the approval authorities may be taken to the City
Council. This appeal is required within 30 days of the approval authority’s action.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 42 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 42 of 50
Item # B
Chapter 9 Off-Street Parking and Loading
Section 9.02 Parking Requirements
9.02.030 Off-Street Parking Requirements
A. Off-Street Parking Requirements Table
The following Table lists minimum off-street parking requirements by land use category.
Table 9.02.030.A: Off-Street Parking Requirements*
Use Category Specific Use General Requirement
Residential Uses
Household Living
Multi-family - Senior 1 per dwelling unit + additional 5% of total spaces for
visitor use
Multi-family
1.5 per 1-bedroom unit
2 per 2-bedroom unit
2.5 per 3-bedroom unit
+ additional 5% of total spaces for visitor use
All other household dwellings 2 per dwelling unit
Group Living
Nursing Home/Hospice/ Assisted
Living 1 per bedroom
All other Group Living 1 per bedroom
Civic Uses
Educational and Day
Care Facilities
Family Home Day Care 2 per home
Group Day Care 6 per home
Commercial Day Care 1 per 400 sq ft GFA
Elementary or Middle Schools 1.5 per classroom + 1 per 2.5 seats capacity for
auditoriums and flexible space
All other Educational Facilities 10 per classroom + 1 per 2.5 seats capacity for
auditoriums and flexible space
Government and
Community
Facilities
Government/Post Office 1 per 250 sq ft GFA + 1 per fleet vehicle
All other Government/ Community
Facilities 1 per 250 sq ft GFA + 1 per fleet vehicle
Medical and
Institutional
Facilities
Hospitals 1 per 2 patient beds
All other Institutions 1 per 250 sq ft GFA
Parks and Open
Areas
Golf Courses and Country Clubs 3 per hole + 1.5 per 250 sq ft GFA of clubhouse and
other structures including pools and tennis courts
Neighborhood Amenity Center 1 per 300 sq ft GFA + 1 additional for every 300 sq ft
GFA over 1800 sq ft GFA including pools
All other Parks and Open Spaces Determined by Director
Places of Worship Religious Assembly 1 per 100 sq ft GFA of sanctuary, classrooms, flexible
seating areas
EXHIBIT A - Revised Proposed Changes to the UDC
Page 43 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 43 of 50
Item # B
Use Category Specific Use General Requirement
Commercial Uses
Mixed-Use Retail
Center* (optional)
Commercial Centers less than
10,000 sq ft including all
Commercial Uses (except Self-
Storage, Agriculture or Landscape
Supply, Funeral, Repair and
Commercial Sales and Service)
1 per 150 sq ft GFA
Automotive Sales
and Services
Car Wash 1 per 200 sq ft GFA (does not include self-service
facility) + 2 spaces
All other Automotive Sales and
Services (except Fuel)
1 per 400 sq ft GFA (indoor only) + 1 additional per
1000 sq ft GFA of outdoor lot, storage or repair bay
area
Overnight
Accommodation
Bed and Breakfast/Inn 1 per guest room + 2 additional spaces
All other Overnight
Accommodations
1 per guest room + 1 per 250 sq ft GFA of
office/conference space
Food and Beverage
Establishments
All Restaurants/Bar/Brewery/
Winery
1 per 100 sq ft of designated seating area/
entertainment area + 4 additional spaces
Food Catering Services 1 per 400 sq ft GFA
Entertainment and
Recreation
Theaters and Stadiums 1 per 250 sq ft GFA + 1 additional per 500 sq ft GFA
up to 50,000 sq ft GFA
All other Entertainment and
Recreation
1 per 400 sq ft GFA + 1 additional per 4 capacity
seating
Health Services
Home Health Care 1 per 400 sq ft GFA
All other Health Services 1 per 200 sq ft GFA
Professional and
Business Offices
Professional Office 1 per 300 sq ft GFA
All other Offices and Services 1 per 400 sq ft GFA
Consumer Retail
Sales and Services
Funeral Home 1 per 150 sq ft GFA
Self Storage (all) 1 per 300 sq ft GFA office space
Small Engine Repair 1 per 400 sq ft GFA
Farmers Market, Agricultural and
Landscape Supply Sales
1 per 400 sq ft GFA +1 additional per 2,500 sq ft indoor
and outdoor storage or staging area
All other Consumer Retail
1 per 250 sq ft GFA for first 20,000 sq ft GFA, 1 per
500 sq ft GFA from 20,000 sq ft GFA up to 100,000 sq
ft GFA
Commercial Sales
and Service All Commercial Sales and Service
1 per 300 sq ft GFA of office/showroom area + 1
additional per 2,500 sq ft indoor and outdoor storage or
staging area
All Other Uses
Transportation,
Utilities and
Communication
All Transportation Terminal or
Dispatch Facilities
1 per 300 sq ft GFA of office; 1 per 400 sq ft GFA of
terminal area + additional spaces as determined by the
Director
Major Utilities 1 per 500 sq ft GFA - minimum of 2
EXHIBIT A - Revised Proposed Changes to the UDC
Page 44 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 44 of 50
Item # B
Use Category Specific Use General Requirement
Industrial
Manufacturing and
Warehousing Uses
Batch Plant/Oil Refinery/
Resource Extraction/Waste
1 per 300 sq ft GFA of office/showroom area + 1
additional per 2,500 sq ft indoor and outdoor storage
area
All other Industrial Manufacturing
and Warehousing
1 per 500sq ft GFA of indoor facility + 1 additional per
2,500 sq ft indoor and outdoor storage area
Agriculture
Farm Stand 2 per stand
Kennel 1 per 300 sq ft GFA of office
Downtown Overlay District
Downtown Overlay
District
Retail buildings greater than
20,000 square feet in Area 1 1 per 1,500 sq ft GFA
All other uses in Area 1 No off-street parking requirement
Residential Uses in Area 2 See the Household Living parking
requirements of this table
Applies only to Development in
Area 2 of the Downtown Overlay
District. See Section 5.04.020.L
for larger buildings in Area 1 of the
Downtown Overlay DistrictNon-
Residential Uses in Area 2†
1 per 500 sq ft GFA for allowed Non-Residential uses
Allowed Residential Uses shall be consistent with the
requirements for Residential Uses (above)
*The required number of parking spaces for uses not listed in the above Table will be determined by the
Director. Alternative Parking Plans may be requested in accordance with Section 9.02.050.
†No parking required for outdoor seating areas where a primary indoor restaurant is present.
9.02.040 Rules for Computing Requirements
9.02.050 Alternative Parking Plans
9.02.060 Alternative Parking Plans in the Downtown a Historic Overlay District
A. General. Within any Historic Overlay District or the Downtown Overlay District, the Historic and
Architectural Review Commission Historic Preservation Officer, or designee, shall be authorized
to approve alternatives to providing the number of off-street parking spaces required in
accordance with this Section.
B. Procedure. Alternative Parking Plans shall be reviewed and approved by the Historic and
Architectural Review Commission Historic Preservation Officer, or designee following the
procedures of the Administrative Exception process established in Section 3.16 of this Code.
C. Recording of Approved Plans. Where an Alternative Parking Plan requires use of property other
than the subject property, an attested copy of an approved Alternative Parking Plan must be
recorded with the County Clerk on forms made available in the Planning and Development
Department. An Alternative Parking Plan may be amended by following the same procedure
required for the original approval. The applicant shall provide proof of recording prior to
approval of the Certificate of Occupancy.
D. On-Street Parking. The Historic and Architectural Review Commission Historic Preservation
Officer, or designee, may approve counting on-street parking spaces to satisfy the requirements
for off-street parking. Such on-street parking shall be located on public right-of-way immediately
EXHIBIT A - Revised Proposed Changes to the UDC
Page 45 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 45 of 50
Item # B
abutting the subject property and shall be reviewed by the Development Engineer for compliance
with City’s standards for use of rights-of-way.
E. Off-Site Parking. The Historic and Architectural Review Commission Historic Preservation
Officer, or designee, may approve the location of required off-street parking spaces on a separate
lot from the lot on which the principal use is located if the off-site parking complies with all of the
following standards.
1. Ineligible Activities. Off-site parking may not be used to satisfy the off-street parking
standards for residential uses (except for guest parking), restaurants (except in the
Downtown Overlay District), convenience stores, or other convenience-oriented uses.
Required parking spaces reserved for persons with disabilities may not be located off-site.
2. Location. No off-site parking space may be located more than 900 feet from the primary
entrance of the use served (measured along the shortest legal pedestrian route) unless
remote parking shuttle service is provided. Off-site parking spaces may not be separated
from the use served by a street right-of-way with a width of more than 80 feet, unless a
grade-separated pedestrian walkway is provided or other traffic control or remote parking
shuttle service is provided.
3. Zoning Classification. Off-site parking areas require the same or a more intensive zoning
classification than required for the use served.
4. Agreement for Off-Site Parking. In the event that an off-site parking area is not under the
same ownership as the principal use served, a written agreement between the record owners
will be required. The agreement must be for a specified time, and guarantee the use of the
off-site parking area for a minimum of five years. An attested copy of the agreement between
the owners of record must be submitted to the Historic and Architectural Review
Commission Historic Preservation Officer, or designee, for recording in form established by
the City Attorney. Recording of the agreement must take place before issuance of a Building
Permit or Certificate of Occupancy for any use to be served by the off-site parking area. An
off-site parking agreement may be terminated only if all required off-street parking spaces
will be provided. No use shall be continued if the parking is removed unless substitute
parking facilities are provided, and the Historic and Architectural Review Commission
Historic Preservation Officer, or designee, shall be notified at least 60 days prior to the
termination of a lease for off- site parking.
F. Shared Parking. The Historic and Architectural Review Commission Historic Preservation
Officer, or designee, may approve shared parking facilities for developments or uses with
different operating hours or different peak business periods if the shared parking complies with
all of the following standards.
1. Location. Shared parking spaces must be located within 600 feet of the primary entrance of
all uses served, unless remote parking shuttle bus service is provided.
2. Zoning Classification. Shared parking areas require the same or a more intensive zoning
classification than required for the use served.
3. Shared Parking Study. Those wishing to use shared parking as a means of satisfying off-
street parking requirements must submit a shared parking analysis to the City that clearly
demonstrates the feasibility of shared parking. The study must be provided in a form
EXHIBIT A - Revised Proposed Changes to the UDC
Page 46 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 46 of 50
Item # B
established by the City and made available to the public. It must address, at a minimum, the
size and type of the proposed development, the composition of tenants, the anticipated rate
of parking turnover, and the anticipated peak parking and traffic loads for all uses that will
be sharing off-street parking spaces.
4. Agreement for Shared Parking. A shared parking plan will be enforced through written
agreement among all owners of record. An attested copy of the agreement between the
owners of record must be submitted to the City for recording in a form established by the
City Attorney. Recording of the agreement must take place before issuance of a Building
Permit for any use to be served by the off-site parking area. A shared parking agreement
may be terminated only if all required off-street parking spaces will be provided.
G. Fee-In Lieu of Parking. The Historic and Architectural Review Commission Historic Preservation
Officer, or designee, may approve the acceptance of a fee-in-lieu of required parking in extreme
cases where none of the alternatives above, alone or in combination, provide for the requisite
number of spaces. Such fee shall be based on the cost of land acquisition, construction (including
landscaping and lighting), and the estimated cost of maintenance for a period of ten years. Such
fee shall be placed in a dedicated fund to provide parking solutions in the affected portion of the
Downtown area or other affected project area where the project is not within the Downtown.
H. Other Eligible Alternatives. The Historic and Architectural Review Commission Historic
Preservation Officer, or designee, may approve any other alternative to providing off-street
parking spaces on the site of the subject development if the applicant demonstrates to the
satisfaction of the City that the proposed plan will function equally well in protecting
surrounding neighborhoods, maintaining traffic circulation patterns, and promoting quality
urban design than would strict compliance with otherwise applicable off-street parking
standards. Such alternatives may include, but are not limited to, the use of tandem parking
spaces.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 47 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 47 of 50
Item # B
Chapter 15 Enforcement
Section 15.02 Compliance Required
15.02.030 Demolition by Neglect
A. Upon identification of any property in possible violation of Section 4.08.060 of this Code,
the Building Official shall notify the property owner or person with interest in the real
property, of the possible violation. Such notification shall be in writing and be mailed by
certified mail, return receipt requested. The notification shall state the nature of the
possible violation with sufficient specificity to enable the owner or person with an
interest in the real property to bring the property into compliance with this section. The
notification shall also state that the owner or person with an interest in the real property
shall have 90 days to bring the property into compliance with this Code.
B. The Building Official and Historic Preservation Officer will work with the property
owner to develop a rehabilitation plan. Upon completion of the 90-day grace period, the
Building Official and Historic Preservation Officer will reinspect the property to
determine compliance with this Code. Should the property owner or person with an
interest in the real property fail to bring the property into compliance with the 90-day
grace period, the City shall seek enforcement of this Code under Section 15.03 of this
Code and any applicable provisions of the Georgetown Municipal Code.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 48 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 48 of 50
Item # B
Chapter 16 Definitions
Section 16.02 Definitions
Alteration. Any exterior change or modification in the architectural appearance and design, other than
cosmetic or decorative, or in supporting members of a building, such as bearing walls or partitions,
columns, beams or girders; or a complete rebuilding of the roof or the exterior walls. Alteration also
includes the removal, stripping or concealing of any significant exterior architectural feature that is
integral to the historic character of a building or structure that is designated as a local Historic Landmark
or contributing to the Historic District. Alteration does not include modifications that qualify as
“Ordinance Maintenance and Repair” as this term is defined in this Code.
Building Wall Surface Area. The total vertical wall area, including windows, of a building when seen
in an elevation view of the building. Roofs, including mansard roofs, having a slope of greater than 65
degrees shall be considered part of a wall surface for the purposes of this ordinance. (See for comparison
“Roof”.)
Certificate of Design Compliance Appropriateness (CDCCoA). A certificate documenting
approval by the Historic and Architectural Review Commission (HARC) or the Historic Preservation
Officer (HPO) to construct, reconstruct, alter, restore, remove, relocate, or demolish any exterior building
or structure that is designated as a Historic Landmark or located in a Historic Overlay District, including
specific site features including but not limited to architectural elements, such as signage, and
fenceslandscaping within the Old Town and Downtown Overlay Districts or any other established
Historic District.
Demolition. The complete intentional destruction, razing, dismantling or removal in whole or in part of
a building or structure; or the intentional destruction or removal of more than 30 percent of the
perimeter walls; or removal of any portion of a street-facing façadeany dismantling, intentional
destruction or removal of sites, surfaces, utilities or other improvements.
Demolition by Neglect. Demolition of a building that is in a serious state of disrepair and
deterioration due to lack of proper maintenance, and for which certain measures must be taken in order
to preserve the public health, safety and welfare.
Downtown and Old Town Design Guidelines. A Council-adopted ordinance that provides
guidance and approval criteria for the Historic and Architectural Review Commission, along with the
Historic Preservation Officer, when reviewing design compliance and proper preservation practices for
proposed projects in the Downtown and Old Town Historic Overlay districts.
Historic Architectural Features. Architectural features that are unique to the design, style and period
of the historic structure.
Historic District or Site, designated. Any site, District, or area, building, or structure of historical,
archeological, or cultural importance or value which the City Council determines by action shall be
protected, preserved, or enhanced in the interest of the culture, prosperity, education, and welfare of the
people.
Historic Landmark. A building, structure or site of historical, architectural, or cultural importance or
value to the City of Georgetown that has been designated as a “landmark” by ordinance of the City
Council and that is to be protected, preserved, restored, and enhanced in the interest of the culture,
prosperity, education, and welfare of the people.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 49 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 49 of 50
Item # B
Historic Preservation Officer (HPO). A person designated to review development applications in
the Downtown and Old Town a Historic Overlay Districts. The HPO presents findings and
recommendations to the Historic and Architectural Review Commission and any other duties granted
them by this Code.
Historic Structure. A building or structure that is a) 50 years or more, and b) associated with
significant people or events, or c) conveys a character of building and design found during the City’s
period of significance. Historic structure also includes a building that has been designated as a local
Historic Landmark, or that is contributing to the historic overlay district.
Historic Structure, contributing. A building in a designated historic overlay district that supports the
district’s historical significance through location, design, setting, materials, workmanship, feeling and
association. Buildings identified as low, medium and high priority structures in the 1984 and 2007
Historic Resources Survey of Georgetown, Texas by Hardy, Heck & Moore, as amended, shall be
considered contributing Historic Structures for purposes of this Code. For the purpose of demolition
only, buildings or structures listed in this survey and that are located outside of a historic overlay district
shall be considered contributing historic structures.
Historic Structure, non-contributing. A building in a designated historic overlay district that does
not support the district’s historic significance through location, design, setting, materials, workmanship,
feeling and association. Buildings that are not identified in the 1984 and 2007 Historic Resources Survey
of Georgetown, Texas by Hardy, Heck & Moore, as amended, shall be considered non-contributing
historic structures for purposes of this Code.
Reconstruction. Rehabilitation or replacement of a building or structure which either have has been
damaged, altered, or removed, or are is proposed to be altered or removed.
Secretary of the Interior’s Standards for the Treatment of Historic Properties. The standards
established by the Secretary of the Interior for providing guidance on the preservation, rehabilitation,
restoration and reconstruction of historic properties.
Street Facing Façade. The building façade or wall that is parallel to a street lot line.
Structure, High Priority (Historic). Any structure designated a high priority in the Historic
Resources Survey of Georgetown, Texas by Hardy, Heck & Moore, 1984 as amended from time to time
by the Preservation Officer to reflect an updating of the list.
Substantial Alteration. Any exterior change or modification in the architectural appearance and
design or supporting members of a building, such as bearing walls or partitions, columns, beams or
girders; or a complete rebuilding of the roof or the exterior walls, unless such modification qualifies as
“Ordinary Maintenance and Repair” as that term is defined in this Code.
EXHIBIT A - Revised Proposed Changes to the UDC
Page 50 of 50
Deleted language is strikethrough Page 1 of 1
Added language is underline
Chapter 1 General Provisions
Section 1.14 Downtown and Old Town Design Guidelines
The Design Guidelines for the Downtown and Old Town Overlay Districts, adopted as Ordinance No.
2001-48, as amended from time to time, is hereby adopted by reference as if set forth in full. The Design
Guidelines establish criteria to guide improvements to properties and work within the Downtown
Overlay District, and Old Town Overlay District, and Historic Overlay District.
Attachment number 1 \nPage 50 of 50
Item # B
New comments are highlighted in blue
Printed on 3/17/2015 Page 1 of 11
COMMENTS RECEIVED PROPOSED CODE SECTION ACTION
1 Clarify definition of the Downtown and Old
Town Design Guidelines
Ch. 1; Sec. 1.14 Included
2 HARC should also render advice and guidance
on properties designated as a Historic Landmark
Ch. 2; Sec. 2.03.010.C.2 Included
3 Public Notification should be required for
Administrative Certificate of Appropriateness
(CoA)
Ch. 3; Sec. 3.03 Not included - It is recommended that all
administrative applications be reviewed in a
consistent manner.
4 Required findings section should be subject to
meeting the Approval Criteria for the
designation of a Historic Overlay District or
Historic Landmark
Ch. 3; Sec. 3.06.06 and Sec.
3.06.07
Included - Required findings has been
incorporated in the Criteria for Approval
5 Criterion no. 6 of the approval criteria for
designating a Historic Overlay District should not
be included
Ch. 3; Sec. 3.06.060.A Included - Criterion has been removed.
6 Clarify required findings for designating a
Historic Overlay District
Ch. 3; Sec. 3.06.060.B Included
7 National Register criteria should be used for
designating Historic Landmarks
Ch. 3; Sec. 3.06.070 Included - Criteria for the designation of local
Historic Landmarks includes criteria from the
National Register Criteria for Evaluation.
8 The amount of review that would apply to non-
historic structures should not be all-inclusive
Ch 3; Tbl. 3.13.010 Included - Applicability of review process has
been clarified for historic and non-historic
structures.
9 Non-street facing façade additions to a
contributing historic structure should be
reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Not included - Currently, the UDC does not
require review for new additions that are not
visible from a street. However, due to the
importance of contributing historic structures, it
is recommended that these additions be
reviewed at the staff level to ensure the
addition is in keeping with applicable guidelines
and standards.
10 New additions to non-contributing historic
structures that are inconsistent with the historic
overlay district standards should be reviewed by
the HARC
Ch. 3; Tbl. 3.13.010 Included - New additions that do not comply
with the zoning standards of the Historic Overlay
District require review and approval by the
HARC.
11 Awnings and canopies for Historic Landmarks
should be reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Included
12 New awnings and canopies for contributing
historic structures should be reviewed by the
HARC
Ch. 3; Tbl. 3.13.010 Included
13 New awnings and canopies for non-contributing
historic structures should be reviewed by the
HPO
Ch. 3; Tbl. 3.13.010 Included
Proposed revisions to UDC requirements related to HARC and Historic Structures and Districts
Public Comments and Feedback
EXHIBIT B - Updated Summary of Public Comments
Attachment number 2 \nPage 1 of 11
Item # B
New comments are highlighted in blue
Printed on 3/17/2015 Page 2 of 11
COMMENTS RECEIVED PROPOSED CODE SECTION ACTION
Proposed revisions to UDC requirements related to HARC and Historic Structures and Districts
Public Comments and Feedback
14 Porches, patios or decks for a contributing
historic structure should be reviewed by the
HARC
Ch. 3; Tbl. 3.13.010 Included - Applicable only to street facing
façades.
15 New porches, patios or decks for a non-
contributing structure should be reviewed as
these may impact the character of the district
Ch. 3; Tbl. 3.13.010 Included - New porches, patios or decks of a
street facing façade of a non-contributing
structure is proposed to be reviewed by the
HPO. Applicable only to street facing façades.
16 CoA requirement for awnings/canopies, paint,
and attached exterior lighting to a residential
structure in the Old Town Overlay District
should not be required
Ch. 3; Tbl. 3.13.010 and Sec.
3.13.010.B
Part Included - New awnings or canopies, paint,
and lighting attached to a single-family or two-
family residential structure in the Old Town or
Downtown overlay districts will not require
review of a CoA, with the exception of those
structured designated as a Historic Landmark.
17 Exclude CoA requirement to replacements,
alterations and modifications to residential
structures in the Old Town Overlay District
Ch. 3; Tbl. 3.13.010 Part Included (explanation) - Due to the
importance of contributing historic structures, it
is recommended that certain modifications or
alterations to the street facing façade of a
contributing historic structure or Historic
Landmark be subject to review. This does not
include alterations made to non-contributing
historic structures or non-street facing facades.
Ordinary maintenance and repair does not
require a CoA.
18 Replacing historic architectural features with a
non-historic architectural feature should be
reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Included
19 Replacing roof materials with different roof
materials should be reviewed by the HARC for
Historic Landmarks and contributing historic
structures
Ch. 3; Tbl. 3.13.010 Part Included - HARC review for Historic
Landmarks; HPO review for contributing historic
structures.
20 Modifications to exterior steps and stairways of
a contributing historic structure should be
reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Not Included - This type of modification is
considered to be a minor project that may be
reviewed administratively.
Included
21 Modifications to exterior steps and stairways
using in-kind materials of a non-contributing
historic structure should be reviewed by the
HPO
Ch. 3; Tbl. 3.13.010 Not included - This type of modification is
considered to be a minor project that should not
be reviewed.
22 Paint removal from a historic and significant
architectural feature should be reviewed by the
HARC
Ch. 3; Tbl. 3.13.010 Not Included - This type of modification is
considered to be a minor project that may be
reviewed administratively.
23 New paint on unpainted historic and other
significant architectural features should be
reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Not Included - This type of modification is
considered to be a minor project that may be
reviewed administratively.
EXHIBIT B - Updated Summary of Public Comments
Attachment number 2 \nPage 2 of 11
Item # B
New comments are highlighted in blue
Printed on 3/17/2015 Page 3 of 11
COMMENTS RECEIVED PROPOSED CODE SECTION ACTION
Proposed revisions to UDC requirements related to HARC and Historic Structures and Districts
Public Comments and Feedback
24 Changes in color to awning fabric that are
inconsistent with the district and landmark
characteristics should be reviewed by the HARC
for Historic Landmarks
Ch. 3; Tbl. 3.13.010 Not Included - This type of modification is
considered to be a minor project that may be
reviewed administratively. HPO has the ability to
refer the application to HARC if application does
not meet the Design Guidelines standards.
25 Exterior lighting that is attached to a building
designated as a Historic Landmark should be
reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Not Included - This type of modification is
considered to be a minor project that may be
reviewed administratively.
26 Removing residential awnings and canopies of a
Historic Landmark should be reviewed by the
HARC
Ch. 3; Tbl. 3.13.010 Included - Requirement was clarified to include
both residential and non-residential awnings
27 Removal of awnings and canopies from a
contributing historic structure should be
reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Included
28 Removing inappropriate (non-historic) exterior
architectural features should be reviewed by
the HARC
Ch. 3; Tbl. 3.13.010 Not Included - This type of modification is
considered to be a minor project that may be
reviewed administratively.
29 Demolition of non-historic additions, and
attached carports, porches, patios or decks that
are made of non-historic materials to a Historic
Landmark or contributing historic structure
should be reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Not Included - This type of modification is
considered to be a minor project that may be
reviewed administratively.
30 Reopening enclosed porches, patios or decks
should be reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Not Included - This type of modification is
considered to be a minor project that may be
reviewed administratively.
31 Demolition of less than 30% of the square
footage of a contributing historic structure
should be reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Not Included - This type of modification is
considered to be a minor project that may be
reviewed administratively. See comment #33.
32 Demolition of 15% or more of the square
footage of a Historic Landmark or a contributing
historic structure should be reviewed by the
HARC
Ch. 3; Tbl. 3.13.010 Included
33 Demolition of 30% of more of the square
footage of a Historic Landmark or a contributing
historic structure should be reviewed by the
HARC as previously proposed
Ch. 3; Tbl. 3.13.010 Not Included - Based on the majority of the
comments received, 30% appears to be too high
of a number when it comes to demolition of a
historic structure, as this may greatly impact its
historic significance and the City's historic
resources. Thus, the number was reduced to
15% as recommended. See comment #33.
34 Demolition of any percentage of a Historic
Landmark or contributing historic structure
should be reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Part Included - Demolitions of small percentages
of a structure are considered to be minor
projects that may be reviewed administratively.
See comment #33.
EXHIBIT B - Updated Summary of Public Comments
Attachment number 2 \nPage 3 of 11
Item # B
New comments are highlighted in blue
Printed on 3/17/2015 Page 4 of 11
COMMENTS RECEIVED PROPOSED CODE SECTION ACTION
Proposed revisions to UDC requirements related to HARC and Historic Structures and Districts
Public Comments and Feedback
35 Demolition or removal of any feature and of any
percentage (of a non-contributing historic
structure) should be reviewed at a minimum by
the HPO. There should not be an item under
"Removal, Demolition or Relocation" that does
not trigger a review.
Ch. 3; Tbl. 3.13.010 Not Included - The items that do not require
review in this specific section are related to non-
contributing historic structures, which are
structures that do not support the district's
historical significance. Because of this, there is
no loss in the historic significance of the district
should these items be removed or demolished.
It is important to note that any new
construction, addition and certain modifications
would be reviewed by the HARC or HPO, as
applicable, to ensure that the character of the
district is preserved.
36 Demolition of non-contributing historic
structures located within a National Register
District should be reviewed by the HARC or HPO
and require public notification
Ch. 3; Tbl. 3.13.010 Not Included - Adopted standards are only
applicable to local Historic Overlay Districts
within the City's jurisdiction.
37 Relocation of a building or structure on the
same lot or Historic Overlay District should be
reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Part Included - HARC review for relocation
within the same district; HPO review for
relocation within the same lot.
38 Relocation of building to ETJ and County should
be allowed in lieu of demolition
Ch. 3; Tbl. 3.13.010 Included - Table was revised to clarify relocation
outside of a historic overlay district (to inside
and outside City's jurisdiction).
39 Signage in all Historic Overlay Districts (and
National Register Districts) should be reviewed
by the HARC
Ch. 3; Tbl. 3.13.010 Not Included - This type of modification is
considered to be a minor project that may be
reviewed administratively.
40 New fences, railings or walls consistent with the
overlay district's characteristics and guidelines
should be reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Not Included - This type of improvement is
considered to be a minor project that may be
reviewed administratively.
41 Removal of a chainlink, plywood or vinyl fence
to be replaced with wood, wrought iron or
masonry fence should be reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Not Included - This type of modification is
considered to be a minor project that may be
reviewed administratively.
42 Fences for residential properties in the Old
Town Overlay District should be exempt from
the CoA process. However, if it must be
reviewed, fences for contributing and non-
contributing historic structures should be
reviewed by the HPO, and for Historic
Landmarks by the HARC
Ch. 3; Tbl. 3.13.010 and Sec.
3.13.010.B
Part Included - Fences play a major role in the
character and historic significance of the district.
Because of this, all fences including residential
fences (as established in the current regulations)
are proposed to be reviewed by the HPO
(regardless of the historic significance of the
structure). Only fences that are inconsistent
with the adopted standards would require
approval by the HARC.
43 New residential construction (infill) and
additions in the Old Town Overlay District
should not be exempt from the CoA review
process
Ch. 3; Sec. 3.13.010.B Not Included - Residential infill construction in
the Old Town Overlay District will be reviewed in
the future through a separate process.
EXHIBIT B - Updated Summary of Public Comments
Attachment number 2 \nPage 4 of 11
Item # B
New comments are highlighted in blue
Printed on 3/17/2015 Page 5 of 11
COMMENTS RECEIVED PROPOSED CODE SECTION ACTION
Proposed revisions to UDC requirements related to HARC and Historic Structures and Districts
Public Comments and Feedback
44 Exterior paint color (new, change and removal)
should be exempt for residential properties in
the Old Town Overlay District
Ch. 3; Sec. 3.13.010.B.5 Included - All single-family and two-family
residential structures (in the Old Town and
Downtown Overlay Districts) are exempt from
the CoA process for exterior paint.
45 Demolition of a Historic Landmark that is
considered a dangerous structure or where
demolition is necessary due to safety concerns
should not be exempt from CoA process
Ch. 3; Sec. 3.13.010.B.6 Not Included - Additional language was included
to require the coordination with the HPO and
property owner to identify salvageable materials
and the proper documentation of the structure
prior to demolition.
46 Timeline should be assigned for Final Action of
an Administrative CoA
Ch. 3; Sec. 3.13.020.A.4.a Part Included - Timeline for administrative
review processes are established in the UDC
Development Manual. The Manual will be
revised to reflect that a decision on an
Administrative CoA will take approximately 10
working days after deeming the application
complete.
47 Criteria for Approval for a CoA (HPO and HARC
Approval) should include compliance with the
Secretary of the Interior's Standards
Ch. 3; Sec. 3.13.020.B and Sec.
3.13.030.B
Included - Proposed design must be in keeping
with the Secretary of the Interior's Standards for
the Treatment of Historic Properties.
48 Criteria for Approval should include consistency
with the Historic Overlay District
Ch.3; Sec. 3.13.020.B.4 Included
49 Criteria for Approval should read that the design
is "compatible" with the Historic Overlay District
Ch. 3; Sec. 3.13.020.B.4 Included
50 Allow HARC to request clarification or additional
information upon review of the application in
advance of the meeting
Ch. 3; Sec. 3.13.030.A.2.b Not Included - This is not part of the Application
Completeness review process as this is an
administrative review that consists solely in
determining that the minimum required
materials were submitted with the application.
51 A recommendation by the HPO to HARC should
be required
Ch. 3; Sec. 3.13.030.A.3.c Included - HPO's report will include a
recommendation for final action on items
requiring HARC final action.
52 Criterion No. 8 appears to be unnecessary due
to the remaining criteria for approval of a CoA
by the HARC
Ch. 3; Sec. 3.13.030.B.8 Included - Criteria for Approval has been
simplified.
53 "Site" from Criterion No. 8 should not be
omitted from the effect a proposed change may
have upon the general character of the district
Ch. 3; Sec. 3.13.030.B.8.a Included - See comment 38 above.
54 Criterion No. C.1.b should refer to compatibility
with the historic character of the District
Ch. 3; Sec. 3.13.030.C.1.b Included - See comment #50
EXHIBIT B - Updated Summary of Public Comments
Attachment number 2 \nPage 5 of 11
Item # B
New comments are highlighted in blue
Printed on 3/17/2015 Page 6 of 11
COMMENTS RECEIVED PROPOSED CODE SECTION ACTION
Proposed revisions to UDC requirements related to HARC and Historic Structures and Districts
Public Comments and Feedback
55 Concern with Criterion No. 1 for Approval for
the relocation, removal or demolition of a
Historic Landmark or contributing historic
structure
Ch. 3; Sec. 3.13.030.F.1 Included - Criterion has been clarified to state
that only circumstances that are unique to the
building proposed to be relocated or
demolished may be considered when reviewing
the request.
56 Concern with Criterion No. 2 for Approval for
the relocation, removal or demolition of a
Historic Landmark or contributing historic
structure
Ch. 3; Sec. 3.13.030.F.2 Included - Criterion has been removed
57 Approval Criteria should include a finding that
"A structure should never be demolished as a
matter of convenience."
Ch. 3; Sec. 3.13.030.F.2 Not Included - Finding may be too subjective
and open to interpretation, particularly as there
is no clear definition of "convenience."
58 Criteria for Approval for demolition based on
Loss of Significance should not be the burden of
the applicant
Ch. 3; Sec. 3.13.030.F.3.a Not Included - Process is only applicable to
significant historic structures. Structures that
are not considered to be historically significant
would not be reviewed through the CoA
process.
59 Clarify review process for buildings or structures
that are relocated, removed or demolished
without approval of a CoA
Ch. 3; Sec. 3.13.040 Included
60 Appeal process - Include recommendation from
HARC to CC
Ch. 3; Sec. 3.13.080 Not Included - Standard process requires
appellate body to consider same request,
documentation and supporting information as
decision making body, in addition to meeting
minutes. All motions must include
findings/reason for final decision.
61 Historic Landmark designation (status) should
be recorded at the County Clerk's Office
Ch. 4; Sec. 4.08.020.D Included
62 General Guidelines for Historic Overlay Districts
should also apply to National Historic Register
Districts
Ch. 4; Sec. 4.08.050 Not Included - Adopted Guidelines are only
applicable to Historic Overlay Districts within the
City's jurisdiction.
63 General Guidelines for all Historic Overlay
Districts should include compliance with the
Secretary of the Interior's Standards
Ch. 4; Sec. 4.08.050 Part Included - See Criteria for Approval in Sec.
3.13
64 Designated Historic Districts should continue to
use the adjective "Overlay"
Ch. 4; Sec. 4.04.050.B Not Included - Designated Historic Districts is a
type of Historic Overlay District. Including the
word "Overlay" may cause confusion in
applicable standards that are unique and
specific to a Designated Historic District and that
may not apply to other Historic Overlay Districts.
EXHIBIT B - Updated Summary of Public Comments
Attachment number 2 \nPage 6 of 11
Item # B
New comments are highlighted in blue
Printed on 3/17/2015 Page 7 of 11
COMMENTS RECEIVED PROPOSED CODE SECTION ACTION
Proposed revisions to UDC requirements related to HARC and Historic Structures and Districts
Public Comments and Feedback
65 Concern with the designation process for a
Historic Landmark (no timeline for
implementation)
Ch. 4; Sec. 4.08.050.D Not Included - Process to designate Historic
Landmarks must be adopted and in effect prior
to initiating designation process. By including
this Section in the Code, the City or interested
property owner may initiate the process to
designate a building, structure or site a local
Historic Landmark.
66 Demolition by Neglect should include
contributing and non-contributing historic
structures to a Historic Overlay District
Ch. 4; Sec. 4.08.060.A Included - Requirement was clarified to include
all buildings in a Historic Overlay District and/or
designated as a Historic Landmark.
67 Floor-to-Area-Ratio (FAR) for buildings within
the Old Town Overlay District should be 0.45
Ch. 4; Sec. 4.08.080.E Included - FAR has been reduced to 0.45
68 Alternative Parking Plans in the Downtown and
Old Town overlay districts should be reviewed
by the HARC
Ch. 9; Sec. 9.02.060 Not Included - Proposed change is to process all
Alternative Parking Plans in a consistent
manner. The purpose of this Plan is to allow the
use of other existing parking facilities when
required parking may not be provided on site.
69 Clarification is needed on the term "upon
identification" for Demolition by Neglect
Ch. 15; Sec. 15.02.030.A Not Included - All cases will be identified and
reviewed through existing code enforcement
processes.
70 Definition of Alterations should not omit
cosmetic or decorative features
Ch. 16; Sec. 16.02 Not Included - Cosmetic and decorative features
are not considered to be structural, permanent
features.
71 Certificate of Design Compliance should not
change to Certificate of Appropriateness
Ch. 16; Sec. 16.02 Not Included - As the term implies,
Appropriateness is used to identify compatibility
with the character of the historic district or
landmark, as well as design guidelines, which
were adopted to guide improvements and
preservation.
72 Clarify definition of "Demolition by Neglect"Ch. 16; Sec. 16.02 Included - Definition now includes outcome due
to negligence.
73 Definition of "Historic Landmark" should include
site (i.e. cemeteries)
Ch. 16; Sec. 16.02 Included
74 Add a definition for "Historic Overlay District" to
distinguish from the National Register Historic
District
Ch. 16; Sec. 16.02 Not Included - All zoning districts, to include the
Historic Overlay District, are defined in Chapter
4 of the UDC.
75 Add a definition for "National Register Historic
District"
Ch. 16; Sec. 16.02 Not Included - The definitions chapter of the
UDC defines words, terms and phrases
contained within the UDC, which does not
include the title National Register Historic
Districts.
EXHIBIT B - Updated Summary of Public Comments
Attachment number 2 \nPage 7 of 11
Item # B
New comments are highlighted in blue
Printed on 3/17/2015 Page 8 of 11
COMMENTS RECEIVED PROPOSED CODE SECTION ACTION
Proposed revisions to UDC requirements related to HARC and Historic Structures and Districts
Public Comments and Feedback
76 Low priority structures should be included in the
definition of "Historic Structure, contributing"
Ch. 16; Sec. 16.02 Included - Definition now includes low, medium
and high priority structures.
77 Definition of "Historic Structure, contributing"
and "Historic Structure, non-contributing"
should be revised to include both the 1984 and
2007 Historic Resource Surveys
Ch. 16; Sec. 16.02 Included
78 Clarify definition on "Historic Structure; non-
contributing"
Ch. 16; Sec. 16.02 Included - Definition has been expanded to
clarify that non-contributing historic structures
include structures in a Historic Overlay District
but not listed in the Historic Resource Survey.
79 Add a definition for "Minor Project" and "Major
Project"
Ch. 16; Sec. 16.02 Not Included - The proposed amendment does
not define projects as "minor" or "major", but
rather lists each potential project that may
require a CoA.
80 Definition of "Street Facing Façade" should
include all street lot lines
Ch. 16; Sec. 16.02 Included
81 Clarify definition of "Street Facing Façade" to be
a wall or elevation parallel to or visible from a
street lot line
Ch. 16; Sec. 16.02 Included - Street facing façade is defined as a
building wall/elevation parallel to a street lot
line to eliminate interpretation of what is
"visible."
82 Applicability of CoA and review process should
differ between the Old Town and Downtown
Overlay Districts as commercial and residential
properties should be treated differently
Ch. 3; Sec. 3.13.010 Not Included - The proposed amendment
eliminates the distinction between residential
and non-residential properties, save for a few
minor exceptions as specified in the proposed
amendment, as the purpose of these standards
is to protect and preserve the City's historic
resources. Because of this, the applicability and
review process was shifted to be determined by
the type and level of historic significance of the
structure (regardless of the use).
83 Projects (Scope of Work) that may be subjective
(i.e. roof materials and exterior paint color)
should be reviewed by the HARC
Ch. 3; Tbl. 3.13.010 Not Included - The review authority for each
scope of work was determined based on the
level of review and type of project, and all
activities must comply with the applicable
standards adopted by the City. City staff will look
at administrative steps and policy decisions to
reduce the level of subjectivity in the review (i.e.
detailed checklists, report to HARC on submitted
administrative CoAs).
Other (General) Comments
EXHIBIT B - Updated Summary of Public Comments
Attachment number 2 \nPage 8 of 11
Item # B
New comments are highlighted in blue
Printed on 3/17/2015 Page 9 of 11
COMMENTS RECEIVED PROPOSED CODE SECTION ACTION
Proposed revisions to UDC requirements related to HARC and Historic Structures and Districts
Public Comments and Feedback
84 Demolition process should apply to buildings
and structures that may be eligible to be
designated as a Historic Landmark. This would
allow City staff to review a demolition request
to determine if the structure proposed to be
demolished is eligible to be designated as a
Historic Landmark and thus give the City the
opportunity to preserve a historic resource. If
so, staff can initiate the process for the
designation. Should it be determined that the
structure should be designated, the structure
may be preserved. To the contrary, if it is
determined that the structure should not be
designated, the structure may then be
demolished. Including this provision in the
process will strengthen the City's goal of historic
preservation.
Ch. 3; Tbl. 3.13.010 and Sec.
3.13.030.E
Not Included - One of the objectives of the
proposed amendment is to provide and increase
the notification of historic properties within the
City's jurisdiction to ensure that property
owners are aware they own or are in the
process of acquiring a historic property that is
subject to additional standards and review. Staff
recommends postponing this recommendation
to be reviewed further at a future date and
through the standard UDC amendment process.
85 Review process between adoption of UDC
amendments and new/revised Historic Resource
Survey
Ch. 16; Sec. 16.02 Included - Definitions revised to clarify
applicability during transition period. Current
structures listed in the Survey will be subject to
CoA review.
86 Require (Pre-Application) Conceptual Review for
Infill Construction and major alterations or
restoration
Not Included - Part of HARC's duties include
rendering guidance, upon request by the
property owner, on new construction or
alterations. This will remain an option to all
interested stakeholders. Process to request
guidance may be established administratively
through the Development Manual applications.
87 Review of a change in use from residential to
non-residential should remain with the HARC
Not Included - All review pertaining to the use
will follow existing zoning processes. However,
modifications and other necessary
improvements to the building because of a
change in use will be reviewed by the HPO or
HARC, as applicable.
88 Balance in the responsibility of the HPO and
HARC
Included - Certain modifications and
improvements were shifted back to HARC
review due to the significant impact it may have
on historic properties and in keeping within the
purpose and mission of the HARC.
89 Better define the duties, roles and responsibility
of the HARC
Included
90 Allow more than one HARC member to be part
of the Demolition Subcommittee should they
meet the Architect/Structural Engineer/Historic
Preservationist criteria
Included - To be addressed in the City Code
EXHIBIT B - Updated Summary of Public Comments
Attachment number 2 \nPage 9 of 11
Item # B
New comments are highlighted in blue
Printed on 3/17/2015 Page 10 of 11
COMMENTS RECEIVED PROPOSED CODE SECTION ACTION
Proposed revisions to UDC requirements related to HARC and Historic Structures and Districts
Public Comments and Feedback
91 Submittal and status of administrative CoA
applications should be made available online
and/or through email notification
Noted - City staff will look at administrative
processes and policies to update stakeholders
on application statuses.
92 HPO should report to the HARC administrative
CoAs that have been reviewed and final action
taken
Noted - City staff will look at administrative
processes and policies to keep the HARC
informed of actions taken on Administrative
reviews.
93 All National Registered properties should be
designated as Historic Landmarks
Noted - City staff will look at properties that are
in the National Register to determine eligibility
for local Historic Landmark.
94 Designation of Historic Landmarks requires
additional research to determined eligibility
Included - Designation of a Historic Landmark
will be determined by the purpose of this district
and the criteria for approval. It is important to
note that designation of Historic Landmarks may
not be initiated until this HL designation,
including the process for designation, is
established in the UDC.
95 Designation of a Historic Landmark should
require consent by the property owner
Not Included - Designation of a specific "zoning"
district (as a Historic Landmark designation
would function) may be approved by the City
Council if they determine that this designation is
in the best interest and benefit of the city. It is
important to note that the property owner
subject to the designation, as well as all
property owners within a 200-ft radius, will be
notified of the request and be given the
opportunity to express any objections or
support at each public hearing of the process.
96 Designation of a Historic Landmark should not
require consent by the property owner as
currently proposed
Included - Designation of a Historic Landmark is
proposed to be similar to the designation of a
zoning district. This determination will be made
based on the approval criteria specific to
Historic Landmarks.
97 Tax Incentives should be provided to properties
designated as a Historic Landmark
Noted - City staff is looking at tax incentives as
part of the City's historic preservation program.
98 Requiring a higher level of review for properties
designated as a Historic Landmark may upset
homeowners and deter interest in designating
properties a local Historic Landmark
Noted - City staff will look at administrative
processes and policies to educate property
owners on the benefits of a local Historic
Landmark designation, as well as to aid in the
preservation of these structures.
99 There must be a balance between preservation
of Historic Landmarks and property rights
Noted - City staff will look at administrative
processes and policies to aid in the preservation
of the City's historic resources while respecting
property owner rights.
EXHIBIT B - Updated Summary of Public Comments
Attachment number 2 \nPage 10 of 11
Item # B
New comments are highlighted in blue
Printed on 3/17/2015 Page 11 of 11
COMMENTS RECEIVED PROPOSED CODE SECTION ACTION
Proposed revisions to UDC requirements related to HARC and Historic Structures and Districts
Public Comments and Feedback
100 New construction, modification and removal of
structures listed as High Priority structures in
the 1984 and 2007 Historic Resource Surveys
should be treated as "Historic Landmarks" for
the purpose of determining level of review
(review by HARC) until a new/updated Historic
Resource Survey identifying structures that may
be designated as local landmarks is adopted by
the City.
Noted - City staff will look at administrative
processes and policies to preserve the historic
integrity of these structures. See Comments #66
and #86.
101 Should the City find itself without a qualified
HPO, all administrative CoAs should be
forwarded to the HARC for review and approval
Noted - As part of the CLG program, the City is
required to have a qualified HPO on staff.
However, should this situation occur, City will
explore all options, to include forwarding these
cases to the HARC.
102 No CoA should be reviewed by the HPO Not Included - The purpose of the HPO is to
coordinate programs furthering historic
preservation, which includes the administration
of the adopted Downtown and Old Town Design
Guidelines for new construction, alterations,
restoration and demolition.
103 Streamline the process for commercial
properties
Included - In an effort to streamline the process
for both residential and non-residential
properties, the applicability of the CoA has been
determined based on the scope of work.
104 Demolition requests that are reviewed and
approved by the HPO should require review by
an oversight/review committee consisting of
two HARC members and select staff members
(Planning, Building Official, etc.)
Not Included - Demolitions that are approved
administratively are proposed to follow policies
and procedures for administrative review. Other
city permitting staff also currently review
demolitions and will continue that process.
105 Concern with assigning administrative review to
the HPO with no action by HARC - According to
the Bylaws, HARC has the authority to delegate
review of minor projects.
Noted - The adopted bylaws are to implement
powers and duties as established by the City
Code. Bylaws and other policies will be amended
to be consistent with the revised regulations.
106 Chapter 4 should include a subsection for
"National Register Historic Districts"
Not Included - The UDC is only applicable to
local designations and districts within the City's
jurisdiction.
EXHIBIT B - Updated Summary of Public Comments
Attachment number 2 \nPage 11 of 11
Item # B
Printed on Mar. 16, 15 Page 1 of 6
COMPARISON OF APPROVAL AUTHORITY
Level of Review to be determined by:
• Type of Structure: Historic Landmark, and Contributing and Non-Contributing Historic Structures
- Review is no longer location based (Downtown vs Old Town Overlay Districts). Applicable
standards for each district will still apply.
- Review is no longer use based (residential vs non-residential structures), except some minor
projects (UDC Section 3.13.010.B).
• Project/Scope of Work: Development that includes more than one type of project will be subject to
the individual review by the entities specified in the list.
• Projects proposed to be exempt from the Certificate of Appropriateness review process include, but
are not limited to:
- New single and two-family residential in the Old Town Overlay District provided the building is in
compliance with the zoning standards of the Historic Overlay District.
- New additions to existing single and two-family structures provided the addition does not create
or add to a street facing façade, and the addition in combination with the existing building is in
compliance with the zoning standards of the Historic Overlay District.
- New, modifications or removal of existing awnings, canopies, exterior paint color or exterior
lighting that are attached to a single-family or two-family residential structure provided the
alterations do not alter the exterior wall of a building designated as a Historic Landmark.
- Demolition of a building or structure that the Building Official has determined necessary for the
preservation of the public health, safety and welfare.
Project (Scope of Work) Historic Significance Approval Authority
HARC = Historic and Architectural Review Commission * HPO = Historic Preservation Officer * NR = Not Required
+ New Items Change in Review
New Construction (Infill Development)
New building construction All Historic Overlay Districts HARC
Additions
To create or add to an existing street
facing façade
Historic Landmark +HARC
Contributing Historic Structure HARC
Non-Contributing Historic
Structure HPO
Non-street facing façades
Historic Landmark +HARC
Contributing Historic Structure +HPO
Non-Contributing Historic
Structure NR
New addition does not comply with the
zoning standards of the historic overlay
district
Historic Landmark +HARC
Contributing Historic Structure HARC
Non-Contributing Historic
Structure HARC
EXHIBIT C - Revised Comparison of Approval Authority
Attachment number 3 \nPage 1 of 6
Item # B
Printed on Mar. 16, 15 Page 2 of 6
Project (Scope of Work) Historic Significance Approval Authority
HARC = Historic and Architectural Review Commission * HPO = Historic Preservation Officer * NR = Not Required
+ New Items Change in Review
Awning or canopy
Historic Landmark +HARC
Contributing Historic Structure* HARC HPO
Non-Contributing Historic
Structure* HPO NR
Porch, patio or deck
Historic Landmark +HARC
Contributing Historic Structure* HARC
Non-Contributing Historic
Structure* HPO NR
Reconstruction, Alterations, Changes
Restoring original door or window
openingshistoric architectural feature
Historic Landmark +HPO
Contributing Historic Structure* HPO
Non-Contributing Historic
Structure NR
Replacing a historic architectural
feature with a non-historic architectural
feature
Historic Landmark +HARC
Contributing Historic Structure* HARC
Non-Contributing Historic
Structure NR
Replacing roof materials with different
roof materials
Historic Landmark +HARC
Contributing Historic Structure HPO
Non-Contributing Historic
Structure NR
Modifications to exterior steps,
stairways and ramps using in-kind
material
Historic Landmark +HPO
Contributing Historic Structure* HPO
Non-Contributing Historic
Structure NR
Modifications to exterior steps,
stairways and ramps
Historic Landmark +HARC
Contributing Historic Structure* HARC HPO
Non-Contributing Historic
Structure* HPO
EXHIBIT C - Revised Comparison of Approval Authority
Attachment number 3 \nPage 2 of 6
Item # B
Printed on Mar. 16, 15 Page 3 of 6
Project (Scope of Work) Historic Significance Approval Authority
HARC = Historic and Architectural Review Commission * HPO = Historic Preservation Officer * NR = Not Required
+ New Items Change in Review
Paint removal from historic and
significant architectural features (back
to original condition; does not include
repainting)
Historic Landmark +HPO
Contributing Historic Structure* HPO
Non-Contributing Historic
Structure NR
Changes to paint color on previously
painted surfaces (includes repainting or
new paint on previously painted
surface)
Historic Landmark +HPO
Contributing Historic Structure* HPO
Non-Contributing Historic
Structure* HPO
New paint on unpainted historic and
other significant architectural features
Historic Landmark +HPO
Contributing Historic Structure* HPO
Non-Contributing Historic
Structure NR
Changes in color to awning fabric
Historic Landmark +HPO
Contributing Historic Structure* HPO
Non-Contributing Historic
Structure* HPO
Exterior lighting that is attached to the
building or structure
Historic Landmark +HPO
Contributing Historic Structure* HPO
Non-Contributing Historic
Structure* HPO
Rooftop HVAC, mechanical or
communication equipment that result in
no modifications to the building façade
Historic Landmark* +HPO
Contributing Historic Structure* HPO
Non-Contributing Historic
Structure* HPO
Rooftop HVAC, mechanical or
communication equipment that result in
modifications to the building façade
Historic Landmark +HARC
Contributing Historic Structure* HARC
Non-Contributing Historic
Structure* HPO
EXHIBIT C - Revised Comparison of Approval Authority
Attachment number 3 \nPage 3 of 6
Item # B
Printed on Mar. 16, 15 Page 4 of 6
Project (Scope of Work) Historic Significance Approval Authority
HARC = Historic and Architectural Review Commission * HPO = Historic Preservation Officer * NR = Not Required
+ New Items Change in Review
Removal, Demolition or Relocation
Awnings or canopies
Historic Landmark +HARC
Contributing Historic Structure* HARC HPO
Non-Contributing Historic
Structure NR
Exterior non-historic architectural
features
Historic Landmark +HPO
Contributing Historic Structure* HPO
Non-Contributing Historic
Structure NR
Exterior siding to unencapsulate
historic siding materials
Historic Landmark +HPO
Contributing Historic Structure* +HPO
Non-Contributing Historic
Structure NR
Removal, stripping, concealing, or
destruction of any historic and
architectural features that is integral to
the historic character of the building or
structure, or historic overlay district
Historic Landmark +HARC
Contributing Historic Structure* HARC
Non-Contributing Historic
Structure* HPO
Non-historic additions that are made of
non-historic materials
Historic Landmark +HPO
Contributing Historic Structure HPO
Non-Contributing Historic
Structure NR
Attached carport, porch, patio or deck
Historic Landmark +HARC‡
Contributing Historic Structure* HARC‡
Non-Contributing Historic
Structure NR
Attached carport, porch, patio or deck
made of non-historic materials
Historic Landmark +HPO
Contributing Historic Structure* HPO
Non-Contributing Historic
Structure NR
EXHIBIT C - Revised Comparison of Approval Authority
Attachment number 3 \nPage 4 of 6
Item # B
Printed on Mar. 16, 15 Page 5 of 6
Project (Scope of Work) Historic Significance Approval Authority
HARC = Historic and Architectural Review Commission * HPO = Historic Preservation Officer * NR = Not Required
+ New Items Change in Review
Reopen enclosed porch, patio or deck
to original condition
Historic Landmark +HPO
Contributing Historic Structure* HPO
Non-Contributing Historic
Structure NR
Street facing façade
Historic Landmark +HARC‡
Contributing Historic Structure HARC‡
Non-Contributing Historic
Structure NR
30%15% or more of the square
footage of a building
Historic Landmark +HARC
Contributing Historic Structure HARC
Non-Contributing Historic
Structure NR
Less than 30%15% of the square
footage of a building
Historic Landmark +HARC
Contributing Historic Structure +HPO
Non-Contributing Historic
Structure NR
Relocation of a building or structure on
the same lot
Historic Landmark +HPO
Contributing Historic Structure HPO
Non-Contributing Historic
Structure HPO
Relocation of a building or structure to
a historic overlay district (includes
relocation of buildings or structures
within the same historic overlay
districts)
Historic Landmark +HARC
Contributing Historic Structure HARC
Non-Contributing Historic
Structure HARC
Relocation of a building or structure
outside of the historic overlay district
Historic Landmark +HARC
Contributing Historic Structure HARC
Non-Contributing Historic
Structure NR
Signage
Master Sign Plan All Historic Overlay Districts HARC
EXHIBIT C - Revised Comparison of Approval Authority
Attachment number 3 \nPage 5 of 6
Item # B
Printed on Mar. 16, 15 Page 6 of 6
Project (Scope of Work) Historic Significance Approval Authority
HARC = Historic and Architectural Review Commission * HPO = Historic Preservation Officer * NR = Not Required
+ New Items Change in Review
New signage, to include new signage
that is consistent with an approved
Master Sign Plan
All Historic Overlay Districts HPO
New signage that is inconsistent with
an approved Master Sign Plan or
applicable guidelines
All Historic Overlay Districts HARC
Changes in content or configuration
(re-facing) that do not involve changes
in sign location, dimensions, lighting or
total sign area
All Historic Overlay Districts HPO
Amending an approved Master Sign
Plan All Historic Overlay Districts HARC
Fences
New fence, railing or wall that is
consistent with the overlay district’s
characteristics and applicable
guidelines
All Historic Overlay Districts† HPO
New fence, railing or wall that is
inconsistent with the overlay district’s
characteristics and applicable
guidelines
All Historic Overlay Districts† HARC
Removal of chain, link, plywood, or
vinyl fence and replacing with wood,
wrought iron, or masonry
All Historic Overlay Districts† +HPO
Miscellaneous
HARC exceptions (building height and
+setback variations pursuant to
Section 4.08)
All Historic Overlay District +HARC
Renewal of an expired Certificate of
Appropriateness
All Historic Overlay Districts HPO
Historic Landmark HPO
*Only applicable to a street facing façade
†Only applicable to fences along a street lot line or located in a street yard
‡CLG demo delay period and Demolition Subcommittee review not applicable
EXHIBIT C - Revised Comparison of Approval Authority
Attachment number 3 \nPage 6 of 6
Item # B
&LW\RI*HRUJHWRZQ7H[DV
&LW\&RXQFLO$JHQGD
)HEUXDU\
68%-(&7
3XEOLF+HDULQJDQG)LUVW5HDGLQJRIDQ2UGLQDQFHDPHQGLQJSRUWLRQVRIWKH8QLILHG'HYHORSPHQW&RGH
8'& UHODWLQJWRWKHGHYHORSPHQWVWDQGDUGVUXOHVDQGSURFHGXUHVWKDWDIIHFWSURSHUWLHVORFDWHGLQD
+LVWRULF2YHUOD\'LVWULFWDQGRUOLVWHGRQWKH+LVWRULF5HVRXUFH6XUYH\0DWW6\QDWVFKN+LVWRULF
'LVWULFW3ODQQHU$QGUHLQD'DYLOD3URMHFW&RRUGLQDWRUDQG/DXULH%UHZHU$VVLVWDQW&LW\0DQDJHU DFWLRQ
UHTXLUHG
,7(06800$5<
%DFNJURXQG
7KH&LW\&RXQFLOKHOGDZRUNVKRSRQ0D\WRUHYLHZDQGGLVFXVVWKHUXOHVDQGUHJXODWLRQV
JRYHUQLQJWKH+LVWRULFDQG$UFKLWHFWXUDO5HYLHZ&RPPLVVLRQ +$5& DQG+LVWRULF2YHUOD\'LVWULFWV&LW\
&RXQFLOH[SUHVVHGFRQFHUQVUHJDUGLQJGHYHORSPHQWVWDQGDUGVUXOHVDQGSURFHGXUHVWKDWDIIHFWSURSHUWLHV
ORFDWHGLQD+LVWRULF2YHUOD\'LVWULFWDQGRUDUHOLVWHGRQWKH+LVWRULF5HVRXUFH6XUYH\2Q0D\
&RXQFLODSSURYHG5HVROXWLRQ1R1 ([KLELW' GLUHFWLQJVWDIIWRLQLWLDWHDQH[HFXWLYH8QLILHG
'HYHORSPHQW&RGH 8'& DPHQGPHQWRXWVLGHRIWKHJHQHUDO8'&$GYLVRU\&RPPLWWHHSURFHVVWRDGGUHVV
WKRVHFRQFHUQV6WDIISURYLGHGDJHQHUDORYHUYLHZRIUHFRPPHQGHGFKDQJHVWR&LW\&RXQFLODWWKHLU
ZRUNVKRSRQ2FWREHUZKHUH&RXQFLOZDVVXSSRUWLYHRIWKRVHUHFRPPHQGDWLRQVLQFOXGLQJ
LQFUHDVHGVWDIIUHYLHZUHYLVHGGHPROLWLRQSURFHGXUHVDQGFUHDWLRQRIKLVWRULFODQGPDUNGHVLJQDWLRQV6WDII
DOVRSURYLGHGXSGDWHUHSRUWVWR+$5&DQGWKH8'&$GYLVRU\&RPPLWWHHRQ2FWREHUDQG
1RYHPEHUUHVSHFWLYHO\
3URSRVHG8'&&KDQJHV ([KLELW$
5HQDPLQJ
&HUWLILFDWHRI'HVLJQ&RPSOLDQFH &'& WHUPLQRORJ\ZDVFKDQJHGWR&HUWLILFDWHRI$SSURSULDWHQHVV &R$
WREHFRQVLVWHQWZLWKVWDWHDQGQDWLRQDOVWDQGDUGV
+LVWRULF6WDWXV
+LVWRULFVWDWXVRIDVWUXFWXUHLVSURSRVHGWREHGLYLGHGLQWRFRQWULEXWLQJYHUVXVQRQFRQWULEXWLQJKLVWRULF
VWUXFWXUHVWRDGLVWULFWZKLFKZRXOGLQIOXHQFHDSSOLFDEOHUHTXLUHPHQWV7KHXSFRPLQJQHZ+LVWRULF5HVRXUFH
6XUYH\ZLOOFODULI\WKLVVWDWXV%HFDXVHRIWKLVRQHRIWKHSURSRVHGFKDQJHVLQFOXGHWKHUHYLHZRIKLVWRULF
VWUXFWXUHVLQDOO+LVWRULF2YHUOD\'LVWULFWVFRQVLVWHQWO\WKXVHOLPLQDWLQJWKHQHHGWRGLVWLQJXLVKDSSOLFDWLRQ
UHYLHZSURFHVVHVEHWZHHQWKH2OG7RZQDQG'RZQWRZQ2YHUOD\'LVWULFWV
$GGLWLRQDOO\DQHZGHVLJQDWLRQ+LVWRULF/DQGPDUNKDVEHHQFUHDWHGWKDWZRXOGLQFOXGHORFDOEXLOGLQJV
VWUXFWXUHVRUVLWHVGHVLJQDWHGYLDRUGLQDQFHWKDWDUHFRQVLGHUHGWKH&LW\
VKLJKHVWSULRULW\KLVWRULFUHVRXUFHV
ZLWKLQWKH&LW\¶VMXULVGLFWLRQ7KHXSFRPLQJQHZ+LVWRULF5HVRXUFH6XUYH\ZLOOKHOSLGHQWLI\EXLOGLQJVDQG
VWUXFWXUHVWKDWPD\EHHOLJLEOHIRUORFDO+LVWRULF/DQGPDUNGHVLJQDWLRQ1RQHWKHOHVVLQWHUHVWHGSURSHUW\
RZQHUVPD\LQLWLDWHWKHSURFHVVIRU+LVWRULF/DQGPDUNGHVLJQDWLRQIROORZLQJWKHHIIHFWLYHGDWHRIWKLV
DPHQGPHQWVKRXOGLWEHDSSURYHG1RWLILFDWLRQUHTXLUHPHQWVKDYHEHHQLQFRUSRUDWHGLQWRWKH+LVWRULF
/DQGPDUNGHVLJQDWLRQSURFHVVZKHUHE\SURSHUW\RZQHUVZRXOGEHFRPHDSSULVHGRIWKHKLVWRULFVWDWXVRI
WKHLUSURSHUW\DQGZRXOGKDYHRSSRUWXQLWLHVWRFRPPHQWDWSXEOLFKHDULQJV$+LVWRULF/DQGPDUN
'HVLJQDWLRQZRXOGEHLQDGGLWLRQWRDFRQWULEXWLQJVWUXFWXUHVWDWXVEXWZRXOGQRWEHUHVWULFWHGWRWKRVH
VWUXFWXUHVZLWKLQDKLVWRULFRYHUOD\
$SSURYDO$XWKRULW\
$SSURYDODXWKRULW\IRUGLIIHUHQWW\SHVRISRWHQWLDOVLWXDWLRQVDVZHOODVEXLOGLQJVWDWXVHVKDVEHHQEURNHQ
GRZQDQGFODULILHGXWLOL]LQJDFKDUWLQWKHSURSRVHG&HUWLILFDWHRI$SSURSULDWHQHVVVHFWLRQRIWKH8'&
6HFWLRQ )LQDODSSURYDODXWKRULW\KDVEHHQUHYLVHGWRLQFUHDVHDSSOLFDWLRQVWKDWFRXOGUHFHLYH
DGPLQLVWUDWLYHDSSURYDOWKURXJKWKH+LVWRULF3UHVHUYDWLRQ2IILFHU +32 ZKLFKPDLQO\FRQVLVWRIWKHUHYLHZ
RIFHUWDLQLPSURYHPHQWVRUPRGLILFDWLRQVXQGHUFOHDUJXLGHOLQHVDQGVWDQGDUGVHVWDEOLVKHGLQWKHDGRSWHG
8'&DQG'RZQWRZQDQG2OG7RZQ'HVLJQ*XLGHOLQHVWKXVHOLPLQDWLQJWKHQHHGIRULQWHUSUHWDWLRQRU
IXUWKHUFRQVLGHUDWLRQE\DFRPPLVVLRQRUERDUG+RZHYHUWKH+32UHVHUYHVWKHRSWLRQWRVHQGDQ
DSSOLFDWLRQWRWKH+$5&LILWLVIHOWWKDWWKHFRPPLVVLRQ¶VUHYLHZLVQHFHVVDU\GXHWRQRQFRQVLVWHQF\ZLWK
WKH'RZQWRZQDQG2OG7RZQ'HVLJQ*XLGHOLQHV,QWKLVHYHQWWKHFDVHZLOOEHVFKHGXOHGDWWKHQH[W
EXHIBIT D - February 10, 2015 City Council Agenda Item R Cover Sheet
Attachment number 4 \nPage 1 of 3
Item # B
DYDLODEOH+$5&PHHWLQJIRUUHYLHZDQGDSSURYDO,WVKRXOGEHQRWHGWKDWDGGLWLRQDOODQJXDJHZDVLQFOXGHG
LQWKHSURSRVHGDPHQGPHQW KLJKOLJKWHGLQ\HOORZLQWKHDWWDFKHG([KLELW$ WRFODULI\WKDWUHTXHVWV
IRUZDUGHGWRWKH+$5&ZLOOEHVXEMHFWWRSXEOLFQRWLILFDWLRQ7KHVHFWLRQDOVRFODULILHVWKDWVLWHIHDWXUHVODQG
XVHVDQGFHUWDLQHOHPHQWVDUHQRWVXEMHFWWR&R$UHYLHZRUDSSURYDO
*HQHUDOO\DGPLQLVWUDWLYHUHYLHZZRXOGLQFOXGHPLQRUDOWHUDWLRQVWRVWUHHWIDFLQJIDFDGHVQHZDGGLWLRQVWRD
VWUHHWIDFLQJIDoDGHRIDQRQFRQWULEXWLQJVWUXFWXUH SURYLGHGDOODSSOLFDEOH]RQLQJVWDQGDUGVDUHPHW
H[WHULRUSDLQWFRORUURRIWRSPHFKDQLFDOHTXLSPHQWIHQFHVDORQJDVWUHHWORWOLQHRUZLWKLQDVWUHHW\DUG
LQGLYLGXDOVLJQDJH H[FOXGLQJPDVWHUVLJQSODQV FHUWDLQSDUWLDOGHPROLWLRQVDQGUHQHZDORIH[SLUHG&R$V
+$5&UHYLHZZRXOGLQFOXGHFRQVWUXFWLRQRIDQHZEXLOGLQJ H[FOXGLQJUHVLGHQWLDOLQWKH2OG7RZQ2YHUOD\
'LVWULFW DGGLWLRQVDQGFHUWDLQDOWHUDWLRQVWR+LVWRULF/DQGPDUNVDQGFRQWULEXWLQJKLVWRULFVWUXFWXUHVURRIWRS
PHFKDQLFDOHTXLSPHQWWKDWUHVXOWVLQPRGLILFDWLRQVWRDVWUHHWIDFLQJIDoDGHFHUWDLQLPSURYHPHQWVWKDWDUH
QRWLQNHHSLQJZLWKWKHVWDQGDUGVJXLGHOLQHVGHPROLWLRQRID+LVWRULF/DQGPDUNRUFRQWULEXWLQJKLVWRULF
VWUXFWXUHDQGPDVWHUVLJQSODQV6HH([KLELW%IRUDFRPSDULVRQRIWKHDSSOLFDEOHDSSURYDODXWKRULW\XQGHU
WKHFXUUHQWSURYLVLRQVYHUVXVWKHDSSURYDODXWKRULW\XQGHUWKHSURSRVHGUHYLVLRQV
3XEOLF1RWLILFDWLRQ
7KHSURSRVHGDPHQGPHQWDOVRLQFOXGHVWKHHOLPLQDWLRQRISXEOLFQRWLILFDWLRQIRUDSSOLFDWLRQVVXEMHFWWR
DGPLQLVWUDWLYHUHYLHZDQGDSSURYDO$SSOLFDWLRQVVXEMHFWWRDGPLQLVWUDWLYHUHYLHZDQGDSSURYDOZLOOEH
UHYLHZHGLQDFFRUGDQFHZLWKDGRSWHGVWDQGDUGVDQGJXLGHOLQHVDSSOLFDEOHWRWKHSURSRVHGVFRSHRIZRUN1R
GHYLDWLRQIURPWKHDGRSWHGVWDQGDUGVPD\EHDOORZHGXQOHVVWKDWGHYLDWLRQLVDSSURYHGIROORZLQJWKHSURSHU
SURFHVV$SSOLFDWLRQVWKDWGRQRWPHHWWKHDGRSWHGJXLGHOLQHVDQGDSSOLFDEOHVWDQGDUGVZLOOEHVXEMHFWWR
UHYLHZE\WKH+$5&
'HPROLWLRQ
7KHSURFHVVDQGDSSURYDOFULWHULDIRUUHORFDWLRQUHPRYDORUGHPROLWLRQRIDKLVWRULFVWUXFWXUHKDVEHHQ
VLPSOLILHGUHVWUXFWXUHGDQGFODULILHG5HTXLUHPHQWVKDYHEHHQGLIIHUHQWLDWHGEDVHGRQVWUXFWXUHVWDWXVVXFK
DV+LVWRULF/DQGPDUNFRQWULEXWLQJKLVWRULFVWUXFWXUHVQRQFRQWULEXWLQJKLVWRULFVWUXFWXUHVRUGDQJHURXV
VWUXFWXUHV3HQDOWLHVDSSOLFDEOHWRGHPROLWLRQVZLWKRXWSULRU+$5&DSSURYDOKDYHEHHQUHILQHG$GGLWLRQDOO\
WKH'HPROLWLRQ6XEFRPPLWWHHLVSURSRVHGWREHIRUPDOL]HGDVDWKUHHPHPEHUFRPPLWWHHFRQVLVWLQJRIDW
OHDVWRQH+$5&PHPEHUWKH%XLOGLQJ2IILFLDODQGDVWUXFWXUDOHQJLQHHUDUFKLWHFWRUKLVWRULF
SUHVHUYDWLRQLVWWKDWZRXOGSURYLGHDWHFKQLFDOUHYLHZDQGUHFRPPHQGDWLRQWRWKHIXOO+$5&IROORZLQJDVLWH
YLVLWWRWKHVXEMHFWVWUXFWXUH
*HQHUDO
2YHUDOOWKHDSSOLFDEOHVHFWLRQVRI&KDSWHUV KDYHEHHQUHRUJDQL]HGIRUEHWWHUFODULW\DQGLPSURYHGXVH
7KHKLVWRULFRYHUOD\GLVWULFWVLGHQWLILHGLQ&KDSWHUKDYHEHHQJURXSHGWRJHWKHUXQGHURQHKHDGLQJ7KH
UHRUJDQL]DWLRQKDVDOVRSURYLGHGIRUFODULILFDWLRQRIWKHDGPLQLVWUDWLYHDQG+$5&UHYLHZSURFHVVHV,Q
DGGLWLRQEDVHGRQSXEOLFIHHGEDFNWKHIORRUWRDUHDUDWLR )$5 WKUHVKROGIRUWKH2OG7RZQ2YHUOD\'LVWULFW
ZDVUHGXFHGWR
,QWHULP3URYLVLRQV
6LQFHWKHSURSRVHGDPHQGPHQWVUHO\KHDYLO\RQDQHZ+LVWRULF5HVRXUFHV6XUYH\ZKLFKGRHVQRW\HWH[LVW
LQWHULPSURYLVLRQVZHUHRXWOLQHGWRWHPSRUDULO\SURWHFWWKHFLW\¶VKLVWRULFUHVRXUFHV7KHVHSURYLVLRQV
HVWDEOLVKWKDWDQ\VWUXFWXUHOLVWHGRQWKHH[LVWLQJ+LVWRULF5HVRXUFH6XUYH\ V WKDWDUHZLWKLQDKLVWRULFGLVWULFW
ZLOOEHFRQVLGHUHGDFRQWULEXWLQJVWUXFWXUH$OVRDQ\VWUXFWXUHOLVWHGRQWKHVXUYH\WKDWLVQRWZLWKLQD
KLVWRULFGLVWULFWZLOOEHFRQVLGHUHGDFRQWULEXWLQJVWUXFWXUHIRUWKHSXUSRVHVRIGHPROLWLRQ
3XEOLF,QSXW
&LW\VWDIIKDVZRUNHGWRJDWKHUSXEOLFLQSXWWKURXJKRXWWKHUHYLHZDQGDPHQGPHQWSURFHVV&LW\VWDIIKRVWHG
DGRZQWRZQEXVLQHVVRZQHUV¶IRFXVJURXSGHVLJQHGWRJDWKHULQSXWIURPVWDNHKROGHUVWKDWKDGUHFHQWO\EHHQ
WKURXJKWKH+$5&SURFHVV)ROORZLQJWKHDGRSWLRQRI&LW\&RXQFLO5HVROXWLRQ1VWDIIFUHDWHGD
SXEOLFZHEVLWHKWWSV KDUFDPHQGPHQWVJHRUJHWRZQRUJDQGHQFRXUDJHGLQWHUHVWHGFRPPXQLW\PHPEHUVWR
VLJQXSIRUHPDLOXSGDWHV7KHZHEVLWHZDVXSGDWHGGXULQJWKHUHYLHZSURFHVVSURYLGLQJDGGLWLRQDO
LQIRUPDWLRQIRUWKHSXEOLF$FRPPHQWIRUPIRUSXEOLFIHHGEDFNZDVDGGHGWRWKHZHEVLWHWKURXJKZKLFK
VWDIIUHFHLYHGVHYHUDOFRPPHQWV6WDIISXEOLVKHGDGUDIWRIWKHSURSRVHG8'&FKDQJHVRQWKHZHEVLWHRQ
-DQXDU\DQGDSXEOLFPHHWLQJZDVKHOGRQ-DQXDU\WRSURYLGHWKHSXEOLFDQRSSRUWXQLW\WR
GLVFXVVDQGSURYLGHFRPPHQWRQWKHGUDIWODQJXDJHZKHUHVWDIIUHFHLYHGDGGLWLRQDOFRPPHQWV6WDIIKDVDOVR
UHFHLYHGYDULRXVFRPPHQWVIURPWKHSXEOLFYLDHPDLODQGWHOHSKRQHFRQYHUVDWLRQV$FKDUW ([KLELW& KDV
EHHQFUHDWHGWKDWOLVWVDOOSXEOLFFRPPHQWVVWDIIKDVUHFHLYHGWRGDWHDQGLQGLFDWHVZKHWKHUWKRVHFRPPHQWV
KDYHEHHQLQFRUSRUDWHGLQWRWKHSURSRVHG8'&DPHQGHGWH[W
3ODQQLQJDQG=RQLQJ&RPPLVVLRQ5HFRPPHQGDWLRQ 7KH3ODQQLQJDQG=RQLQJ&RPPLVVLRQDWWKHLU
EXHIBIT D - February 10, 2015 City Council Agenda Item R Cover Sheet
Attachment number 4 \nPage 2 of 3
Item # B
UHJXODUO\VFKHGXOHGPHHWLQJRQ)HEUXDU\KHOGDSXEOLFKHDULQJRQWKLVLWHP$WRWDORIQLQH
VWDNHKROGHUVVLJQHGXSWRVSHDNRQWKLVLWHP'XHWRWKHFRQFHUQVH[SUHVVHGE\WKHSXEOLFDWWKHKHDULQJDQG
WKHQHHGIRUIXUWKHUSXEOLFUHYLHZDQGLQSXWWKH3ODQQLQJDQG=RQLQJ&RPPLVVLRQUHFRPPHQGHGGHQLDO
RIWKHDPHQGPHQWDVSURSRVHGZLWKDIXUWKHUUHFRPPHQGDWLRQWKDWWKH&LW\&RXQFLODOORZIRUDGGLWLRQDO
WLPHIRUIXUWKHUSXEOLFUHYLHZFODULILFDWLRQDQGHGLWLQJRIWKHSURSRVHGDPHQGPHQW7KHPDMRUFRPPHQWV
DQGFRQFHUQVGLVFXVVHGDWWKHPHHWLQJDUHVXPPDUL]HGLQWKHDWWDFKHG([KLELW(
1H[W6WHSV
7KHSURSRVHGDPHQGPHQWVDUHVFKHGXOHGIRUVHFRQGUHDGLQJRIWKHRUGLQDQFHRQ)HEUXDU\WK7KH8'&
'HYHORSPHQW0DQXDOZLOOEHXSGDWHGIROORZLQJWKHDSSURYDOWRUHIOHFWWKHDPHQGPHQWV,Q0DUFK
RQFHWKHDPHQGPHQWVDUHHIIHFWLYHWKH+LVWRULF/DQGPDUNGHVLJQDWLRQSURFHVVZLOOEHJLQ6WDIILVFXUUHQWO\
ZRUNLQJWRVHOHFWDFRQVXOWDQWIRUWKHQHZKLVWRULFUHVRXUFHVXUYH\DUHSODFHPHQWRIWKH DQG
KLVWRULFUHVRXUFHVXUYH\V7KHQHZVXUYH\LVSODQQHGWREHJLQWKLV$SULODQGZLOOHVWDEOLVKWKHFRQWULEXWLQJ
YHUVXVQRQFRQWULEXWLQJKLVWRULFVWUXFWXUHVWDWXVDQGZLOOKHOSWRSURYLGHDEDVLVIRUWKHGHVLJQDWLRQRIWKH
KLVWRULFODQGPDUNV
),1$1&,$/,03$&7
1$
68%0,77('%<
/DXULH%UHZHU$VVLVWDQW&LW\0DQDJHU0DWW6\QDWVFKN+LVWRULF3ODQQHUDQG$QGUHLQD'DYLOOD3URMHFW
&RRUGLQDWRU
$77$&+0(176
2UGLQDQFH
([KLELW$8'&$PHQGPHQW7H[W
([KLELW%6XPPDU\RI&KDQJHVLQ)LQDO$FWLRQ$XWKRULW\
([KLELW&3XEOLF&RPPHQWV
([KLELW'5HVROXWLRQ1
([KLELW(3ODQQLQJ =RQLQJ&RPPLVVLRQ0HHWLQJ6XPPDU\
EXHIBIT D - February 10, 2015 City Council Agenda Item R Cover Sheet
Attachment number 4 \nPage 3 of 3
Item # B
Printed on Mar. 17, 15 Page 1 of 2
Exhibit E
Project Timeline
May 27, 2014
City Council adopted Resolution 052714-N directing staff to conduct a comprehensive
review to determine possible amendments to the HARC process, the Unified Development
Code (UDC) and other city regulations to ensure a continued balance between historic
preservation and land use regulations.
October 23, 2104
Staff presented the proposed list of UDC amendments to the Historic and Architectural
Review Commission (HARC) for review at the October 23, 2014 HARC Workshop. The
presentation included the list of proposed amendments and a proposed timeline for the
changes.
October 28, 2014
Staff presented the proposed list of UDC amendments to the City Council for review at the
October 28, 2014 City Council Policy Workshop. The presentation included the list of
proposed amendments and a proposed timeline for the changes. In addition, it outlined the
process for adoption of the proposed amendments, including presentations to the HARC
and UDC Advisory Committee.
November 4, 2014
Staff presented the proposed list of UDC amendments to the UDC Advisory Committee for
review at the November 4, 2014 UDC Advisory Committee Meeting. The presentation
included the list of proposed amendments and a proposed timeline for the changes.
November 10, 2014
List of proposed UDC amendments posted online for review and feedback.
Survey made available online to promote and facilitate the submittal of comments.
January 15, 2015
Draft of proposed UDC amendments posted online for public review and feedback.
January 22, 2015
Open Stakeholder Meeting on the proposed UDC amendments.
January 28, 2015
Update of the proposed UDC amendments was presented to Downtown related boards and
commissions.
January 30, 2015
Revised draft of proposed UDC amendments posted online for public review and feedback.
EXHIBIT E - Project Timeline
Attachment number 5 \nPage 1 of 2
Item # B
Printed on Mar. 17, 15 Page 2 of 2
February 3, 2015
Planning and Zoning Commission Meeting, Public Hearing held and Recommendation to
City Council.
February 5, 2015
City staff was available at a Q&A Session on the proposed UDC amendments, hosted by the
Georgetown Heritage Society.
February 10, 2015
City Council meeting, Public Hearing held and City staff presented First Reading of the
Ordinance for proposed changes to the Unified Development Code (UDC) relating to the
development standards, rules, and procedures that affect properties located in a Historic
Overlay District and/or listed on the Historic Resource Survey.
February 26, 2015
Workshop with the Historic and Architectural Review Commission (HARC) on the
proposed UDC amendments
March 12, 2015
Workshop with property and business owners and other interested members of the public
EXHIBIT E - Project Timeline
Attachment number 5 \nPage 2 of 2
Item # B
City of Georgetown, Texas
City Council Agenda
March 24, 2015
SUBJECT:
Update on Public Safety Operations and Training Center -- Codi Newsom, Senior Project Manager and
Wayne Nero, Chief of Police
ITEM SUMMARY:
General update on the Public Safety Operations and Training Center.
FINANCIAL IMPACT:
N/A
SUBMITTED BY:
Wayne Nero, Chief of Police
Cover Memo
Item # C
City of Georgetown, Texas
City Council Agenda
March 24, 2015
SUBJECT:
Georgetown Fire Department Paramedic and TRV Program -- John Sullivan, Fire Chief
ITEM SUMMARY:
The Georgetown Fire Department currently operates as a First Responder Organization (FRO) that renders
medical care to nearly 80,000 residents within the City and extra-territorial jurisdiction (ETJ). Due to the
growing number of baby-boomers and retirees relocating to Georgetown, the demand for pre-hospital
medical services is expected to increase and will require a more efficient response model by the Fire
Department.
We are proposing the implementation of transitional response vehicles (TRV’s) to allow for a more cost-
effective and efficient medical response. Moreover, these vehicles will be capable of transporting sick and/or
injured people to the hospital or alternate care facility.
The primary role of the TRV will be medical response, care, and transport. The secondary role will include
operational deployment at fire or other specialized emergency incidents. This will allow the fire department
to improve its ability to assemble an effective firefighting force (EFF) within 8-minutes.
FINANCIAL IMPACT:
Pro-forma will be made available to Council
SUBMITTED BY:
John Sullivan, Fire Chief
Cover Memo
Item # D
City of Georgetown, Texas
City Council Agenda
March 24, 2015
SUBJECT:
Sec. 551.071: Consultation with Attorney
- Advice from attorney about pending or contemplated litigation and other matters on which the attorney has
a duty to advise the City Council, including agenda items
- EMS Contract Discussion
- Meet and Confer
Sec. 551.074: Personnel Matters
- Interim City Manager, City Attorney, City Secretary and Municipal Judge: Consideration of the
appointment, employment, evaluation, reassignment, duties, discipline, or dismissal
- Review and discussion of City Manager position
- Interim City Manager Compensation
ITEM SUMMARY:
FINANCIAL IMPACT:
To be determined.
SUBMITTED BY:
Cover Memo
Item # E